KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_18645Help
Entry
A3UG_18645        CDS       T02159                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_18645
Enzymes [BR:enl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     A3UG_18645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4029211..4030644
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITQEVVPGKYYP
NHEAIDFHGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDETQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQEYGAWTNRKVVDFFVRFAEVVFERYKNKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFTINMEPGDEQ
ILREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPHVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHVEEMIKAVTHDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFEWYKGVIASNGETL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaccttaccaaaagattttttatggggcggcgcggttgctgctcaccag
gtggaaggcggctggaacaagggcggcaaagggccgagcatctgtgacgtgctgaccggt
ggtgcacatggcgtcccccgtgaaatcactcaggaagtggtaccgggtaaatactacccc
aaccacgaggccatcgattttcacggccactacaaagaagacatcaagctgtttgccgag
atgggcttcaaatgtttccgcacctctatcgcgtggacgcgcatcttcccgaaaggtgat
gaaacgcagcctaatgaagaagggctgaagttttacgacgatatgttcgatgagttactg
aagtacaacatcgagccggtgatcaccctctcccacttcgaaatgccactgcacctggtg
caggagtatggcgcctggaccaaccgtaaagtggtcgatttctttgtccgtttcgcggaa
gtggtcttcgagcgttacaaaaacaaggtcaaatactggatgaccttcaacgaaatcaac
aatcagcgtaactggcgtgccccgctgttcggctactgctgctccggtgtggtctatacc
gagcacgacaacccggaagagaccatgtaccaggtgctgcatcatcagtttgtggccagc
gccctggcagtgaaagctgcgcgtcgtattaacccggaaatgaaggtcggctgtatgctg
gcgatggtggcgctctatccgttctcctgtaaaccggaggacgtgatgtttgcccaggag
tccatgcgtgaacgctacgtctttaccgacgttcagctgcgcggttactacccgtcttac
gtactgaatgaatgggagcgccgaggtttcaccattaacatggagccgggtgatgagcag
atcctgcgcgaaggtacctgcgactacttaggtttcagctattacatgacgaacgctgtc
aaagccgaaggcggtaccggcgatgcaatttcaggctttgaaggcagcgtgcccaacccg
cacgtgaaagcctctgactggggctggcagattgaccctgtgggtctgcgctactctctg
tgtgagctatacgagcgttatcagaaaccgctgtttatcgtcgagaacggttttggcgcc
tacgataaagtggaagaagacggcagcatcaacgatgactaccgcatcgactatctgcgc
gctcacgtggaagagatgatcaaagccgtgacgcacgatggggttgatctgatgggttac
acaccgtggggctgtatcgactgcgtctctttcaccaccggccagtacagcaagcgctat
ggctttatctatgtgaacaagcacgacgacggcacaggtgacatgtcgcgctcccgtaag
aaaagcttcgagtggtataaaggtgtgattgccagtaacggtgagacgctttaa

DBGET integrated database retrieval system