KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_19610Help
Entry
A3UG_19610        CDS       T02159                                 

Definition
putative lysozyme from lambdoid prophage DLP12
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Brite
Enzymes [BR:enl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     A3UG_19610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4224978..4225487)
Genome map
AA seq 169 aa AA seqDB search
MNSIIKRCSVASVLALAVLMPDFRLLHTSPEGLALIADLEGCRLSPYRCSAGVWTSGIGH
TAGVVPTQAITERDAAANLIADVLNVEKRLAACAPVEMPPRVYDALVSFAFNVGTGAACR
STLVAFIHHKQWPQACDQLTRWVYVNGKKNAGLENRRAREKAWCMQGGR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcaatcattaagcgttgcagcgtcgccagcgtccttgccctggcggtgctcatg
cctgactttcgattactgcacacctcgcctgaagggctggcgttaattgccgatctcgaa
ggctgccgtctttcgccctaccgctgtagcgcgggcgtatggacgtcaggcattggccat
acggcaggcgttgtaccgacgcaggcgatcaccgagcgtgacgcggcggcgaacctgatc
gccgacgttctgaatgttgagaaacggcttgccgcatgcgcgccggtggagatgccaccc
cgtgtctatgacgcgctggtcagttttgcctttaacgtgggaaccggtgccgcctgccgt
tcgacgctggtggcgtttattcatcacaaacagtggccacaggcctgcgatcagctgacc
cgctgggtgtatgtcaacgggaagaagaacgccgggctggaaaaccgtcgggcccgtgaa
aaggcctggtgtatgcaggggggaagatga

DBGET integrated database retrieval system