KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_21875Help
Entry
A3UG_21875        CDS       T02159                                 

Definition
(GenBank) endo-1,4-D-glucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4712117..4713223)
Genome map
AA seq 368 aa AA seqDB search
MMKAFRWCVVGLMLAATPLRAACTWPAWEQFKQDYISEGGRVIDPSDTRKITTSEGQSYA
LFFALAANDRKAFDQVLAWTRDNLAGGHLDDTLPAWLWGQKDKENWAVIDTNSASDADVW
IAWSLLEAGRLWKDADYTRTGKALLKRIAREEVVKVPGLGLMLLPGKVGFADENAWRFNP
SYLPPQLASYFTRFGAPWTTLRETNLRLLLESAPKGFSPDWVQYQKNKGWRLKQDPPLVG
GYDAIRVYLWVGMMSDNDPQKARLLARFQPMAATTIKQGVPPEKVDVASGKRTGNGPVGF
SAAMLPFLQQRDAQAVQRQRVADHFPGNNAYYSYVLTLFGQGWDQHRFRFTTKGELIPDW
GQECASSQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaagcctttcgctggtgtgtagtcggattgatgctggcggcgacgcctcttcgt
gccgcctgcacctggcctgcctgggagcagtttaaacaggattacatcagcgagggcggg
cgggtcattgaccccagtgacacgcgtaaaatcaccacctcggaagggcaaagttacgcg
ctgttctttgccctggccgcgaatgaccgtaaagcgttcgaccaggtgctggcatggacg
cgggataatcttgccggtgggcatctcgacgacacgctccccgcctggctatggggacag
aaagacaaagagaactgggcggtcatcgacaccaattccgcctcggatgccgatgtctgg
attgcctggtcactgcttgaagcgggccggttatggaaagacgccgactacacccgcacg
ggtaaggcgctactcaaacgcattgcccgcgaggaagtggtgaaagtacccggtcttggc
ctgatgttgctcccgggtaaagtgggttttgccgatgaaaacgcctggcgttttaacccc
agctatcttccgcctcagctggcgagctatttcacgcgttttggtgccccgtggactacc
ctgcgtgaaaccaatctgcgcttgctgctggagagtgcgccaaaaggcttttcgccggac
tgggtgcaataccagaaaaacaaaggctggcggttaaagcaggatccgccgctggtggga
ggatacgatgctatccgagtctatctttgggtggggatgatgagcgataacgatccccag
aaagcccggctactggcacgtttccagccgatggccgccacgacaataaaacagggtgtt
ccgccggagaaagtggatgtggcgagcgggaaacgcacgggcaatggcccggtcggcttc
tctgctgccatgctgccttttttacagcagcgtgacgcgcaggccgttcagcgtcagcgt
gtggctgaccattttcccggtaacaatgcctattacagttatgtactgactctctttgga
caaggatgggatcagcatcgttttcgcttcaccacaaaaggtgaattaataccggattgg
ggccaggaatgcgcaagttcacagtaa

DBGET integrated database retrieval system