KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_21950Help
Entry
A3UG_21950        CDS       T02159                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A3UG_21950 (fadB)
   01212 Fatty acid metabolism
    A3UG_21950 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A3UG_21950 (fadB)
   00650 Butanoate metabolism
    A3UG_21950 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    A3UG_21950 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    A3UG_21950 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3UG_21950 (fadB)
   00310 Lysine degradation
    A3UG_21950 (fadB)
   00380 Tryptophan metabolism
    A3UG_21950 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3UG_21950 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A3UG_21950 (fadB)
   00281 Geraniol degradation
    A3UG_21950 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    A3UG_21950 (fadB)
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A3UG_21950 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A3UG_21950 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A3UG_21950 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     A3UG_21950 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4735572..4737761
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQTDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLSAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQAQK
IGLVDGVVKPEKLIEGSLAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
MQTAGKHYPAPITAVKTIEAAARFGRDEALKLENQSFVPLAHTNEARALVGIFLNDQFVK
GKAKQLTKNVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISEKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPVLEYTGFDRVDVVVEAVVENPKVKKAVLAETEEKVRP
ETVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDDTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFEANRFGQKNGLGFWRYKEDSKGKP
KKEEDPAVDSLLAGVSQPKRDFTDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSARYLDMVQQYQHLGPLYDVPEGLRNKARHNETYYPAVEPA
RPVGELKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcaactggctggaagatggcattgccgaactg
gtgttcgatgcccccggctcagtcaataagctcgataccgcgacggtggccagtcttggc
caggcgctggatgtacttgaaaagcaaactgatttaaaagggctgctgctgcgctcgaac
aaagcggcctttattgtcggtgccgatatcaccgaatttctttcactgttcctggtgcct
gaagaacagctgagccagtggctgcactttgccaacagcgtcttcaatcgtctggaagat
ctgcctgtcccgaccctttccgccgttaacggctacgcgctgggcggcggctgtgaatgc
gtgctggccaccgactaccgccttgccacgccggatctgcgcatcggtctgccggaaacc
aaattgggcattatgccgggctttggcggctccgtacgtatgccgcgcatgctgggcgcc
gacagcgccctggaaatcattgccgcaggtaaagatgtcggcgcagagcaggcacaaaaa
atcggcctggtcgatggcgtcgtgaaaccagaaaaactgattgaaggctcccttgccatt
ctgcgccaggccattaacggcgatctcgactggaaggccaaacgccagccgaaactggag
ccgttaaagctcagcaagattgaagcggccatgagcttcaccatcgccaaaggtatggtg
atgcagacggcgggtaaacactacccggcgccgatcacggcggtgaaaaccattgaagcc
gcagcccgctttggccgcgacgaagcactaaagctcgaaaaccagagctttgtcccgctg
gcacacaccaatgaagcccgcgcgctggttggcatcttcctcaacgatcagttcgtgaaa
ggcaaagcaaaacagctgacgaaaaacgttgagacgccaaaacatgcggcggtccttggc
gcaggcattatgggcggcggcatcgcttaccagtccgcctggaagggcgtgccggtggtg
atgaaagacatcagcgagaaatccctgacgctggggatgaccgaagcggccaagctgctc
aataaacagctggaacgcggcaaaattgacggtctgaaactcgcaggcgtgatctccact
atccagcccgtactggaatacaccggttttgaccgcgtcgatgtggtggttgaggccgtg
gtagagaacccgaaagtgaagaaagcggtgctggccgaaacggaagagaaagtgcgtccg
gagaccgtactggcctctaacacctcgacgattccgattagcgagctggcaagcgtcctg
aagcgcccggaaaacttctgcggaatgcatttcttcaacccggtgcaccgtatgccactg
gtcgaagtgatccgcggtgaaaaaacctctgacgataccatcgcaaaagtggtggcgtgg
gcaagcaagatgggcaaaaccccgattgtggtcaacgactgcccgggctttttcgtcaac
cgcgtgctgttcccttacttcgcgggtttcagccagctgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccaatgggtccggcgtatctg
ctggatgtggttggcattgataccgcgcatcatgcacaggcggttatggcagcgggtttc
ccgcagcgcatgcagaaagattatcgcgatgcgattgacgccctgttcgaagctaaccgt
ttcggtcagaaaaacggtctgggcttctggcgctataaagaagacagcaaaggcaaaccg
aagaaagaagaagatccggcggtggatagcctgctggccggggtgagtcagccaaaacgt
gacttcacggacgatgaaatcatcgcccggatgatgattccaatgatcaacgaagtggtg
cgttgcctcgaagaaggcattatcgccagcccggcagaggccgatatggcgctggtctat
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggatacgctcggcagc
gcccgctatctcgatatggtgcagcagtatcaacacctcggcccgctttatgacgtgccg
gaagggctgcgtaacaaagcgcgccataacgaaacctattacccagcagttgagccagcc
cgcccggttggcgagctgaaaacggcttaa

DBGET integrated database retrieval system