KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_22050Help
Entry
A3UG_22050        CDS       T02159                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:enl00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4756050..4757042)
Genome map
AA seq 330 aa AA seqDB search
MLQQKKDWETRENAFAAFSMGPLTDFWRQREEDEFTGVGNIPVRFVRFRDVKNDRVIVVC
PGRIESYIKYAELAYDLFHLGFDVLIIDHRGQGLSGRMLSDTHRGHVDNFSDYVDDLAAF
WQQEVEPGPWRKRYILAHSMGGAISTLFLQRYEHQCDAIALTAPMYGIVMRFPDWMVRHI
LDWAEGHQRIREGYAIGTGRWRALPFALNVLTHSRQRYRRNLRFYADEPRLRVGGPTYHW
VREGILAGEQVLAGVGCDDTPTLLIQAEEERVVDNRMHDRFCELRAAAGHPCEGGKPLVI
NGAYHEILFEKDAMRSVALNAIVEFFDRHN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagcagaaaaaggactgggaaacacgagaaaacgcatttgctgctttctccatg
gggccgctaaccgatttctggcgccagcgtgaggaagatgagtttacaggcgtcgggaat
atcccggtacgctttgttcgtttccgtgatgtaaaaaacgatcgggtcatcgtggtctgt
cccggtcgtattgagagctacattaaatacgccgaactggcctatgacctgttccatctg
ggcttcgacgtgttgattatcgaccaccgcgggcagggactgtccgggcgtatgttatcc
gacacccatcgcggtcatgtggataacttcagcgattatgtcgacgatcttgccgcattc
tggcagcaggaagtcgagcctggcccgtggcgtaagcgctatattctggcacactcgatg
ggcggcgcgatttcaacgctgtttttacaacgttatgagcaccagtgcgatgccattgcg
ctcaccgcgccgatgtatggcatcgtcatgcgttttcctgactggatggtgcgccatatc
cttgactgggctgagggccatcagcgcattcgtgaaggatacgccatcgggacggggcgc
tggcgcgcattgccgtttgctctgaacgtgctgacccatagccggcaacggtatcgtcgt
aacctgcgtttttatgccgatgaaccgcgcctgcgcgtaggtggcccaacgtatcattgg
gtacgggagggcattcttgccggtgaacaggttctggcaggggttggttgtgatgatacg
ccgacgctgctgatccaggcagaagaagagcgtgtggtggataaccgcatgcacgaccgt
ttttgtgaattgcgcgctgccgcgggtcacccctgtgaagggggtaaaccactggtcatc
aacggcgcgtaccatgagatccttttcgaaaaggacgctatgcgctcagtcgcgctcaac
gccattgttgaatttttcgacaggcataactga

DBGET integrated database retrieval system