KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_22465Help
Entry
A3UG_22465        CDS       T02159                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:enl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4854244..4855752
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQSST
LVEVLAKADISSDEIAAIGITNQRETTIVWERETGKPIYNAIVWQCRRTSEICEQLKRDG
MEEYVRSATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNINTLEWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEEHEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaaaaatatattgttgcgctcgaccagggcaccaccagctcccgcgctgtc
gtaatggatcatgacgcgaacattgtcagcgtatcacagcgcgaatttgagcaaatctat
cctcgtccaggctgggtagaacacgaccctatggagatctgggcatcgcaaagctccacg
ctggtcgaagtgctggcgaaagccgatatcagttccgacgagattgctgcgattggtatt
accaaccagcgtgaaacgaccatcgtctgggaacgtgaaaccggcaagcctatctataac
gccatcgtctggcagtgccgtcgtacgtcagagatctgtgaacagcttaagcgcgacggt
atggaagagtacgtccgcagcgccacgggcctcgtcgttgacccgtatttctccggcacc
aaagtgaagtggatccttgaccacgtggaaggttcacgtgagcgtgcaaaacgcggcgag
ctgctgttcggtaccgtcgacacctggcttatctggaagatgacccaggggcgcgttcac
gtcactgactataccaatgcctcacgtaccatgctgttcaacatcaacaccctggagtgg
gatgacaagatgctggacgcgctggatatcccacgcgccatgctgccagaagtgcgtaaa
tcttctgaagtgtacggtcagaccaacatcggtggtaaaggcggcacgcgtattcctatc
gccggtatcgctggtgaccagcaggcggccctgtttggccagctgtgcgtgaaagaaggg
atggcgaaaaacacctacggtaccggctgctttatgctgatgaacactggcgagaaagcg
gtgaaatcagaaaacggtctgctgaccaccatcgcctgtggcccacgcggtgaagtgaac
tatgcgctggaaggtgcggtattcatggcgggggcatccatccagtggctgcgtgacgag
atgaagcttatcagcgatgcattcgactccgaatacttcgctaccaaagtgaaggatacc
aacggtgtgtacgtcgtacctgcgtttaccggtctgggtgcaccgtactgggatccatat
gcacgtggcgcgatttttggcctgacgcgtggtgtgaattctaaccacattattcgcgcc
accctggaatctatcgcctaccagacgcgtgatgtgctggaagcgatgcaggctgactcc
ggtattcgtttgcacgctctgcgcgtggacggcggtgcggtcgcgaacaacttcctgatg
cagttccagtctgacattctgggcacccgcgtggaacgcccggaagtacgtgaagtgacc
gcgctgggtgcagcgtatctcgccggtctggccgtcggcttctggcagaacctggacgag
ctgcaggaaaaagcggttatcgaacgcgaattccgcccgggcatcgaaaccaccgagcgt
aactaccgctacagcggctggaagaaagcggttaaacgtgccctggcgtgggaagagcac
gaagagtaa

DBGET integrated database retrieval system