KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_22490Help
Entry
A3UG_22490        CDS       T02159                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A3UG_22490 (tpiA)
   01230 Biosynthesis of amino acids
    A3UG_22490 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_22490 (tpiA)
   00051 Fructose and mannose metabolism
    A3UG_22490 (tpiA)
   00562 Inositol phosphate metabolism
    A3UG_22490 (tpiA)
Enzymes [BR:enl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A3UG_22490 (tpiA)
Exosome [BR:enl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A3UG_22490 (tpiA)
  Exosomal proteins of bladder cancer cells
   A3UG_22490 (tpiA)
  Exosomal proteins of melanoma cells
   A3UG_22490 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4858970..4859737
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVTGCAVAIAPPDMYLDLAKRAADGSHII
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNASNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgctaacctgcgtacagagctggctggcgtgacaggctgcgcggttgctatc
gctccgccggatatgtacctggatctggctaaacgtgccgctgatggcagccacatcatt
ctgggcgcacagaacgttgacgttaacctgtctggcgcattcaccggtgaaacctctgct
gaaatgctgaaagacatcggcgcgaaatacatcatcatcggccactctgagcgtcgtacc
taccacaaagaatccgacgaattcatcgcgaagaaatttgcggtgctgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagcagaaaacgaagcgggaaaaactgaa
gaagtgtgcgcacgtcagattgacgcggtgctgaaaacgcagggcgcggcagcattcgaa
ggcgcggttatcgcttacgagccagtatgggcgatcggtaccggcaaatctgccacccca
gcgcaggctcaggcggttcacaaattcatccgtgatcacattgcgaaagccgacgcgaaa
gtggcagagcaggttatcatccagtacggcggttccgtaaacgcctccaacgcagctgaa
ctgttcacccagccagacatcgatggcgcgctggttggcggtgcatccctgaaagctgac
gctttcgcggtgatcgttaaagcggcagaagcggctaaacaggcgtaa

DBGET integrated database retrieval system