KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_22490Help
Entry
A3UG_22490        CDS       T02159                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00010  Glycolysis / Gluconeogenesis
enl00051  Fructose and mannose metabolism
enl00562  Inositol phosphate metabolism
enl01100  Metabolic pathways
enl01110  Biosynthesis of secondary metabolites
enl01120  Microbial metabolism in diverse environments
enl01130  Biosynthesis of antibiotics
enl01200  Carbon metabolism
enl01230  Biosynthesis of amino acids
Module
enl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
enl_M00002  Glycolysis, core module involving three-carbon compounds
enl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3UG_22490 (tpiA)
   00051 Fructose and mannose metabolism
    A3UG_22490 (tpiA)
   00562 Inositol phosphate metabolism
    A3UG_22490 (tpiA)
Enzymes [BR:enl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A3UG_22490 (tpiA)
Exosome [BR:enl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A3UG_22490 (tpiA)
  Exosomal proteins of bladder cancer cells
   A3UG_22490 (tpiA)
  Exosomal proteins of melanoma cells
   A3UG_22490 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: AFM62197
Position
4858970..4859737
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVTGCAVAIAPPDMYLDLAKRAADGSHII
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNASNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgctaacctgcgtacagagctggctggcgtgacaggctgcgcggttgctatc
gctccgccggatatgtacctggatctggctaaacgtgccgctgatggcagccacatcatt
ctgggcgcacagaacgttgacgttaacctgtctggcgcattcaccggtgaaacctctgct
gaaatgctgaaagacatcggcgcgaaatacatcatcatcggccactctgagcgtcgtacc
taccacaaagaatccgacgaattcatcgcgaagaaatttgcggtgctgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagcagaaaacgaagcgggaaaaactgaa
gaagtgtgcgcacgtcagattgacgcggtgctgaaaacgcagggcgcggcagcattcgaa
ggcgcggttatcgcttacgagccagtatgggcgatcggtaccggcaaatctgccacccca
gcgcaggctcaggcggttcacaaattcatccgtgatcacattgcgaaagccgacgcgaaa
gtggcagagcaggttatcatccagtacggcggttccgtaaacgcctccaacgcagctgaa
ctgttcacccagccagacatcgatggcgcgctggttggcggtgcatccctgaaagctgac
gctttcgcggtgatcgttaaagcggcagaagcggctaaacaggcgtaa

DBGET integrated database retrieval system