KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_22785Help
Entry
A3UG_22785        CDS       T02159                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:enl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3UG_22785
Enzymes [BR:enl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A3UG_22785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4926609..4927538)
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLVVLGSINADHILNLESFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDTGERVRKQLASDNIDVAPISVVAGESTGVALIFVNAEGENVIGIHAGANARL
TTERVEAQRELIASADALLMQLESPVESVLAAADIAHQNHTTVVLNPAPARVLSDELLAR
VDIITPNETEAEKLTGIRVENDDDAARAAKALHDKGIGTVIITLGSRGVWASVNGEGRRV
PGFKVKAIDTIAAGDTFNGALVTALLEGKGMDDAIRFAHAAAAIAVTRKGAQPSVPWRKE
IDEFLSQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggcaacctcgtcgtccttggcagtatcaatgccgatcacattcttaac
cttgaatccttcccgacgccgggcgaaaccgtcaccggtaaccattaccaggtggcattt
ggcggtaaaggtgccaaccaggcggttgcagcaggacgcagtggggcaaatatcgcgttt
atcgcctgcacgggtgatgacgataccggcgagcgcgtgcgtaaacagctcgccagcgat
aacatcgatgttgcgccaatcagcgttgttgcaggggaatcgaccggcgtggcgctgatt
ttcgtcaacgcggaaggtgagaatgtcatcggtattcatgctggcgcgaatgcccgtctt
acgacggaacgcgttgaagcacagcgcgagcttattgccagtgccgacgcgttactgatg
cagctggaatcgcccgtggaaagcgtactggcggccgctgacattgcgcatcaaaatcat
accactgtcgtacttaatcctgcgcctgcccgtgtactatcagatgaactgctggcgcgg
gtggacatcattacgccgaacgaaaccgaagcggaaaaactgacgggcattcgtgttgaa
aatgatgatgacgcagcgcgtgccgcgaaagcgttgcatgataaaggtatcggcaccgtt
atcattaccctcggcagccgcggcgtgtgggctagcgtaaatggcgaaggccgtcgcgtg
ccgggctttaaggtcaaggcgattgacaccatcgcggcaggcgatacgtttaacggagca
ttggtgacagcgctgctggaaggaaagggaatggacgatgctatccgctttgcgcatgct
gctgcggctatcgccgtcacgcgcaaaggtgcccagccctccgttccatggcgtaaagag
atcgatgaattcttaagtcagcaggggtaa

DBGET integrated database retrieval system