KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_00020Help
Entry
ECENHK_00020      CDS       T02315                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECENHK_00020
Enzymes [BR:eno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECENHK_00020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3252..4181)
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLVVLGSINADHILNLESFPAPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDTGERVRKQLASDNIDIAPVSVVAGESTGVALIFVNAEGENVIGIHAGANAAL
TTARVEAQRALIGGAEALLMQLESPVESVLAAAKIAHENHTTVVLNPAPARVLSDELLAL
VDIITPNETEAEKLTGIRVENDDDAARAAKVLHEKGIGTVIITLGSRGVWASVNGEGRRV
PGFRVKAIDTIAAGDTFNGALVTALLEGKVMDDAIRFAHAAAAIAVTRKGAQPSVPWRKE
IDEFLSQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggtaacctcgtcgtccttggcagtatcaatgccgatcacattcttaac
cttgaatcattccctgcaccgggcgaaaccgtcacgggtaatcattaccaggtagcattt
ggcggtaagggcgcaaaccaggccgtcgccgccggacgcagtggggcgaatattgcgttt
atcgcctgcacgggtgatgacgataccggtgagcgcgtacgtaaacagctggccagcgat
aatattgatatcgcgccggtcagcgttgttgcgggggagtctaccggcgtggcgctgatt
ttcgtcaacgctgaaggtgagaatgtcatcggtattcatgcgggtgctaacgctgcgctg
acgacggcgcgcgtagaagcgcaacgagcactcatcggtggagccgaagccctgctgatg
cagctggagtcaccggttgaaagcgtgctggccgccgccaaaattgcgcatgaaaatcat
accactgtcgtacttaaccctgctccagcccgtgtattatcagacgagttgttggcgctg
gtggacatcattacgccaaacgaaaccgaagcggaaaagctgacgggcattcgtgttgaa
aatgatgatgatgccgcgcgtgcggcgaaagtgttgcatgaaaagggcatcgggaccgtt
atcattactcttggcagtcgtggggtgtgggcaagcgtaaacggcgaagggcgtcgcgtg
ccgggcttcagggttaaagccattgatacgattgccgcaggcgatacctttaacggtgcg
ctggtgacggcgctgctggaaggcaaagtgatggatgatgcgatccgctttgcgcatgcc
gccgccgcaattgcggtgacgcgtaaaggggcacagccttccgtaccgtggcgcaaagag
atcgatgaattcttaagtcagcaggggtaa

DBGET integrated database retrieval system