KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_00705Help
Entry
ECENHK_00705      CDS       T02315                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:eno03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
141680..142489
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSDEIHALSDKPVLSVQRRAKYLL
LELPDGWIIIHLGMSGSLRILTEELPAEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKEL
DGHNVLAHLGPEPLSDAFNAEYLKAKCAKKKSPIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSAQECELLVRVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPVIATKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaggtagagaccagccgccgcggcattgagccccatctggtcggc
gcgacgattcttcatgctgtcgttcgcaatggacgtctgcgctggccggtgtccgatgag
atccacgcgttaagcgataaacccgtgcttagcgtgcagcgccgcgcgaaatacctgctg
ctggagctgcctgacggctggattatcatccatctggggatgtccgggagcctgcgcatc
cttactgaagaactgcccgcggaaaagcacgaccacgtcgatctggtgatgagcaacggc
aaagtgctgcgttacaccgacccacggcgctttggcgcgtggctgtggactaaagagctg
gacgggcacaatgtgctggcgcatctgggcccggagccgctctcagacgcgtttaatgcg
gaatacctgaaagcgaagtgcgcgaagaagaagagcccaattaagccctggctgatggat
aacaagctggtggtcggcgtggggaatatctatgccagcgaatcgctgtttgccgccggg
atccatcccgatcggctggcctcttcactgtcggctcaggagtgcgaactgctggtcaga
gtgattaaagcggtattgctgcgctcgattgagcagggcggaaccacgctgaaggatttc
ctgcaaagcgacggcaagccgggctattttgctcaggagctgcaggtgtatggccgtaaa
ggtgagccatgcagagtctgcggaacgccagttattgccacgaagcacgcacagcgcgcc
acgttctactgccgtcagtgtcagaaatag

DBGET integrated database retrieval system