KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_01270Help
Entry
ECENHK_01270      CDS       T02315                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECENHK_01270
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECENHK_01270
   00630 Glyoxylate and dicarboxylate metabolism
    ECENHK_01270
Enzymes [BR:eno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECENHK_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272364..273965
Genome map
AA seq 533 aa AA seqDB search
MTQQATTVDELAFTQPHGEQEQQILTAEAVEFLTELVTRFTPQRNKLLAARIHQQQEIDD
GKLPGFISETASIRRGEWKIRGIPEDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIEGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAAWWSDVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMNEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKELEARNG
HDGTWIAHPGLADTAMEVFNRVLGDNKNQLFVTREEDAPTAEEQLLAPCAGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRFLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaacgactgtcgacgaactggcctttacccagccgcatggtgagcaa
gaacagcaaatattgacggcagaggcggtcgaatttctgactgaactggtgacccgcttt
acgccgcagcgcaataagctgctggcagcacgcattcaccagcagcaggaaattgacgat
ggcaagttgcctggatttatttcggaaaccgcttccattcgccgtggtgagtggaaaatt
cgtggtattcctgaagatttacaggatcgccgcgttgagatcaccggtccggtagaacgc
aaaatggtgatcaacgccatgaacgcgaacgttaaagtctttatggctgattttgaagac
tcgttggcaccggactggcgtaaggttatcgaggggcaaatcaacctgcgcgacgccgtg
aacggcaccatcagctataccaacgaagccgggaaaatctatcaacttaaaccgaatccg
gcggtgctgatctgtcgcgtacgcggtctccatctgcctgaaaaacacgtcacctggcgt
ggggaagccattcccggcagcctgtttgatttcgcgctctatttcttccacaaccacaaa
aacctgctggcaaaaggcagtggcccctatttctatctgccaaaaacgcaggcctggcag
gaagcggcgtggtggagtgacgtgttcagttatgcagaagatcgtttcaatctgccacgt
ggcaccatcaaagccaccctgttgattgaaacgctgcctgcggttttccagatgaacgaa
attctgcatgccctgcgtgaccacatcgtcggcctgaactgtgggcgttgggactatatc
ttcagctatatcaaaaccctgaaaaattatcccgatcgtgtactgcccgatcgtcaggtc
gtcactatggataagccgttcctgagcgcctactcgcgcctgctgatcaaaacctgccac
aagcgcggtgcctttgcgatgggcggcatggcggcatttattccgagcaaagacgcggag
cgtaacaatcaggtgctcaacaaagtgaaggccgataaagagcttgaagcgcgtaacggt
catgacggaacgtggatcgcccatccgggcctcgcagacacggcaatggaagtctttaac
cgcgtactcggtgacaataaaaatcagctctttgttacgcgcgaagaggatgcgccaacg
gctgaagaacagctgctggcaccgtgtgcaggtgaacgtacggaagagggcatgcgcgcc
aacattcgcgttgcggtgcagtacatcgaagcctggatctctggcaacggctgcgtgccg
atctacggcctgatggaagatgccgccacggcggaaatctcccgcacctctatctggcaa
tggatccatcatcaaaaaacgctcagcaacggcaagccggtgaccaaagccctgttccgc
cagatgctggccgaagaaatgcgggtgatccaggacgagttgggcgaacaccgcttcagc
agcggacgttttgacgatgctgcacgcctgatggaacaaatcaccacctcagatgactta
atcgacttcctgactctgccgggctaccgcttcctggcgtaa

DBGET integrated database retrieval system