KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_01270Help
Entry
ECENHK_01270      CDS       T02315                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECENHK_01270
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECENHK_01270
   00630 Glyoxylate and dicarboxylate metabolism
    ECENHK_01270
Enzymes [BR:eno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECENHK_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272364..273965
Genome map
AA seq 533 aa AA seqDB search
MTQQATTVDELAFTQPHGEQEQQILTAEAVEFLTELVTRFTPQRNKLLAARIHQQQEIDD
GKLPGFISETASIRRGEWKIRGIPEDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIEGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAAWWSDVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMNEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKELEARNG
HDGTWIAHPGLADTAMEVFNRVLGDNKNQLFVTREEDAPTAEEQLLAPCAGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRFLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaacgactgtcgacgaactggcctttacccagccgcatggtgagcaa
gaacagcaaatattgacggcagaggcggtcgaatttctgactgaactggtgacccgcttt
acgccgcagcgcaataagctgctggcagcacgcattcaccagcagcaggaaattgacgat
ggcaagttgcctggatttatttcggaaaccgcttccattcgccgtggtgagtggaaaatt
cgtggtattcctgaagatttacaggatcgccgcgttgagatcaccggtccggtagaacgc
aaaatggtgatcaacgccatgaacgcgaacgttaaagtctttatggctgattttgaagac
tcgttggcaccggactggcgtaaggttatcgaggggcaaatcaacctgcgcgacgccgtg
aacggcaccatcagctataccaacgaagccgggaaaatctatcaacttaaaccgaatccg
gcggtgctgatctgtcgcgtacgcggtctccatctgcctgaaaaacacgtcacctggcgt
ggggaagccattcccggcagcctgtttgatttcgcgctctatttcttccacaaccacaaa
aacctgctggcaaaaggcagtggcccctatttctatctgccaaaaacgcaggcctggcag
gaagcggcgtggtggagtgacgtgttcagttatgcagaagatcgtttcaatctgccacgt
ggcaccatcaaagccaccctgttgattgaaacgctgcctgcggttttccagatgaacgaa
attctgcatgccctgcgtgaccacatcgtcggcctgaactgtgggcgttgggactatatc
ttcagctatatcaaaaccctgaaaaattatcccgatcgtgtactgcccgatcgtcaggtc
gtcactatggataagccgttcctgagcgcctactcgcgcctgctgatcaaaacctgccac
aagcgcggtgcctttgcgatgggcggcatggcggcatttattccgagcaaagacgcggag
cgtaacaatcaggtgctcaacaaagtgaaggccgataaagagcttgaagcgcgtaacggt
catgacggaacgtggatcgcccatccgggcctcgcagacacggcaatggaagtctttaac
cgcgtactcggtgacaataaaaatcagctctttgttacgcgcgaagaggatgcgccaacg
gctgaagaacagctgctggcaccgtgtgcaggtgaacgtacggaagagggcatgcgcgcc
aacattcgcgttgcggtgcagtacatcgaagcctggatctctggcaacggctgcgtgccg
atctacggcctgatggaagatgccgccacggcggaaatctcccgcacctctatctggcaa
tggatccatcatcaaaaaacgctcagcaacggcaagccggtgaccaaagccctgttccgc
cagatgctggccgaagaaatgcgggtgatccaggacgagttgggcgaacaccgcttcagc
agcggacgttttgacgatgctgcacgcctgatggaacaaatcaccacctcagatgactta
atcgacttcctgactctgccgggctaccgcttcctggcgtaa

DBGET integrated database retrieval system