KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_02520Help
Entry
ECENHK_02520      CDS       T02315                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECENHK_02520
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ECENHK_02520
Enzymes [BR:eno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ECENHK_02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542322..544706
Genome map
AA seq 794 aa AA seqDB search
MLRYSLLTAGLLLGASAFAAPAGDLPLMPWPAKVERPTTQGALMLTSQLSVTVSGDDLGD
AVNRLRQRIALQTGWTLQPQAELPDKPTIRIAIAKKVKPQPLPDSDESYKLTVDANGVNI
SANTRFGALRAMETLLQLVQNGAENTSLPWVTIEDAPRFPWRGLLLDSARHFIPIVDIKR
QIDGMAAAKLNVLHWHLTDDQGWRFSSKRYPKLTQLASDGLFYTPEQMREIVRYATERGI
RVVPEIDMPGHASAIAVAYPELMSAPGPYKMERNWGVLKPVLDPTKEATYAFADAMVSEL
AAIFPDPYLHIGGDEVDDSQWKANPAIQQFIRDHTLADSHALQAYFNRKLETILEKHHRQ
MVGWDEIYHPDLPKSILIQSWQGQDALGKVAQTGYKGILSTGFYLDQPQSTAYHYRNEIV
PQGLNGVDVIADTDSAQSWAFSMPRLKGKPVEGSFTLVKGDAGWRGFIDFAGKSRRAVQD
IAWRDDNQVTFTVDTWMGETRPVVSVDNDKLTGYFLVGNTRYPISGTRLDEVPKGIPPVV
PDVANQANLLGGEAALWAENVVAPVLDIRLWPRTFAVAERLWSAQDVNDVDNMYTRLQAM
DSWTTVSVGLQQHTQQQVQFTRLANNADTLPLQILAQALEPAQYYTRQHLKFQAGNYHQF
EPLNRLADALNAESITVRQMNKWADRLVSDAEDTESADALRHVFNRWQSNTSDALALSEN
SYQLKAIKPVILEVDKLATIGLRLTDLVARQGTLDDKEIASIQRELDNAAKVQDEVVIAA
VYPLETLLRATRNQ
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgttacggtacagtctcttaaccgccgggctgctgctcggcgcctctgcctttgccgcc
ccggcaggggatctcccgttaatgccctggcctgcgaaggtggaacgcccgactacgcag
ggtgcactgatgctcaccagccaactttccgtgaccgtcagcggcgacgatctcggcgac
gcggtcaaccgcctgcgtcagcgtatcgccctgcaaaccggctggacgctacagccgcag
gctgagctaccggacaaaccgaccattcgcatcgccatcgccaaaaaggtgaagccgcag
ccgctgccggacagcgatgaaagctataagctcacggtggatgccaacggtgtgaatatc
tccgccaacacccgcttcggcgcgctgcgggcgatggagacgctgcttcagctggtgcaa
aacggcgcggaaaacacgtcgctgccgtgggtgaccattgaagacgcgccgcgcttcccg
tggcgcgggctgctgctcgactcggcgcgccatttcattcccatcgtggatatcaaacgc
cagattgacggcatggcggccgcaaagcttaacgtcctgcactggcacttaaccgacgat
cagggctggcgcttcagctcgaagcgttacccgaagctgacgcagcttgccagcgacggg
ctgttctatacccctgagcagatgcgcgagattgttcgctatgccaccgagcgcggcatc
cgcgtggtgccggagatcgacatgccgggccacgcctcggcgattgctgtggcctacccg
gagctgatgagcgcgccggggccctacaaaatggagcgcaactggggcgtgctgaagccg
gtgcttgatccgaccaaagaggccacatacgcctttgctgacgcgatggtcagcgaactg
gcggcgatcttcccggatccgtatctgcacatcggcggggatgaggtggacgacagccag
tggaaagcgaatcctgccattcagcagtttatacgtgaccacacgctggcggacagccac
gcgctgcaggcctatttcaaccgcaagctggagacgatcctcgagaaacatcatcggcag
atggtcggctgggatgagatctatcatcctgacttaccgaaaagcattctgatccagtcc
tggcaggggcaggacgcgctgggtaaggtggcgcaaaccggctacaagggcattctttcg
accggtttctacctcgatcaaccccagtccaccgcctatcactaccgcaatgaaatcgtt
ccccaggggctgaatggcgtggacgtgatagcagacaccgacagcgcccagagttgggcc
ttctccatgccgcgtctgaaaggcaagccagtcgaggggagttttaccctggtgaaaggg
gacgccggctggcgcggttttattgattttgccgggaaatcccgccgtgcggtgcaggat
attgcgtggcgcgacgacaatcaggtgacgtttaccgttgacacctggatgggcgaaacg
cgcccggtcgtctctgtcgataacgacaagctcaccggttacttcctggtgggcaatacc
cgctatccgattagcggtacccgtctggacgaggtgccgaaagggatcccaccggtagtg
ccggacgtggcgaatcaggctaatttgctcggcggagaagccgcgctgtgggcggaaaac
gtggtcgcaccggtgctggatatccgcctgtggccgcggacgtttgcggtggcggagcgg
ttatggtccgcgcaggacgtcaatgatgtcgacaacatgtatacccgcctgcaggcgatg
gacagctggacgacggtgtcggttggcctgcagcagcatacccagcagcaggtgcaattc
acgcggctcgcgaataatgccgacacgttgccgctgcaaatcctcgcgcaggcgcttgaa
ccggcccagtattacacccgtcagcacctcaagttccaggcgggaaactatcaccagttt
gagccgcttaaccgcctcgcggatgcgctgaatgcggaaagcatcaccgtgcgtcagatg
aacaaatgggcggaccgtctggtgagcgatgcggaagacacggaaagcgccgacgcgctg
cgccacgtctttaatcgctggcagagcaacaccagcgacgcgctggcgctgagcgaaaac
agctatcagctgaaggcgattaaaccggtgatcctggaggtggataagcttgccacaatt
ggcctgaggctgacggatctggtggcgcgacagggcacgctggatgacaaagagatcgcc
tcgattcaacgcgagctggataacgcggcgaaggtgcaggacgaagtggtgattgctgcg
gtgtatccgctggagacgctgctcagggcgacgcgaaaccagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system