KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_03335Help
Entry
ECENHK_03335      CDS       T02315                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECENHK_03335 (deoA)
Enzymes [BR:eno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ECENHK_03335 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709802..711124
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTVSEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFRDIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAQLAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDEAEARAKL
QAVLDNGKAAEIFSRMVAAQKGPTDFVENYAKYLPTATLSKAVYADSEGFVSAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSVDGQRPLAVIHAKDEASWQDAAKAVKAA
ITLADKAPESSPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcattaagcgacgaa
gagatccgcttctttatcaatggcattcgtgataacaccgtctctgaagggcagattgcg
gctctggcgatgaccattttctttcacgatatgtcgatgcccgagcgcgtgtcgctgacc
atggcgatgcgagattcaggaaccgttctggactggaaaagccttaaccttaacggcccg
attgtggacaaacactccaccggcggtgtgggtgacgtgacctccctgatgctgggccct
atggtggccgcctgtggcggttatatcccgatgatttccgggcgcggtctgggccacacc
ggcggtacgctcgacaaactggaagccattccgggcttcgatatcttcccggatgacaac
cgcttccgcgacattattaaagacgtgggtgtggcaattatcggccagaccagctctctt
gccccggcagacaagcgtttctacgcgacccgcgacatcaccgccaccgttgactccatt
ccgttgatcaccgcctctattctggcgaaaaagctggcagaagggctggacgcgctggtg
atggacgtgaaggtgggcagcggtgcctttatgccgacctatgagctttctgcccagctc
gccgaagcgatcgttggcgtctccaacggcgcaggcgtgcgcaccaccgcgctgctcact
gacatgaaccaggtactggcctccagcgccggtaacgcggtcgaagtgcgtgaagccgtc
cagttcctgacgggggaataccgcaacccgcgcctgttcgacgtgaccatggcgctgtgt
gtagagatgctgatctccggcaagctggcgaaagacgaggcggaagcacgcgcgaaactg
caggccgtgctggacaacggcaaagcggcagagatctttagccgtatggtcgccgcacaa
aaaggcccgaccgacttcgttgagaattacgccaaatacctgccaaccgcgacgctcagc
aaagccgtatatgccgacagcgagggctttgtctcagcaatggacacccgtgcgctgggt
atggcggtggtctcgatgggcggcggtcgtcgtcaggcgtcagacaccattgattacagc
gtcggctttaccgatatggcccgtctgggcgacagcgttgatggccaacgtccgctggcg
gtgatccacgccaaagacgaagccagctggcaggacgcggcgaaggcggtgaaagcggcc
attacgcttgctgataaagcaccagaaagctcaccttcggtctatcgccgtatcaccgaa
tag

DBGET integrated database retrieval system