KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_03485Help
Entry
ECENHK_03485      CDS       T02315                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECENHK_03485
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECENHK_03485
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECENHK_03485
Enzymes [BR:eno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ECENHK_03485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743796..745082
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFQLTEIDELLKQDFVTRSTKILS
AFIGDEIPQELLEERVRAAFAFPAPVQQVEPDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPKGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKAALGLNSANSINISRLLAQICYYFEAVAQLQQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLKDGKWAPNATQATLSNA
MDVSQPNNWPRVEELFRRKVWRLVDLGYAAVTDETTKATMRELKAVGYTSEPHAAIAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLPLPKELAERADLPLLSHELPADFAAL
RKLMMTRA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataaccttaaagatcataacgagcaggtcagcttcgcgcaggcagtgact
caggggctgggcaaaaatcaggggctgttcttcccgcatgacctgccggaatttcagctg
accgagattgatgaactgctgaagcaggactttgtcacccgcagcaccaaaattctgtct
gcgtttatcggcgacgaaatccctcaggagctgctggaagagcgcgtgcgtgcggcgttt
gccttcccggctccggtgcagcaggtggagcctgacgtcggttgtctggagctgttccac
ggcccgaccctggcgtttaaagacttcggcggccgctttatggcgcagatgctgacccac
atcagcggcgacaagccggtgaccattctgacagccacctccggcgataccggtgccgcg
gtcgcgcatgcgttctacggcctgaaaaacgtccgcgtggtgatcctctatccaaaaggc
aaaatcagcccgctgcaggaaaaactgttctgtacgctcggcggcaacattgagactgtg
gcgatcgacggtgactttgatgcctgtcaggcgctggtcaagcaggcgttcgatgatgaa
gagctgaaggccgcgctggggctgaattccgccaactccatcaacatcagccgtctgctg
gcgcagatttgctactacttcgaagcggtagcgcagctgcagcaggaagcgcgcaatcag
ctggtggtgtccgtaccaagcggtaacttcggtgacctgacggcgggattactggcgaaa
tcgctcggtctgccggtgaagcgctttatcgccgctaccaacgccaacgacaccgtgccg
cgcttcctgaaagacgggaaatgggcaccgaacgcgacgcaggcaacgctctccaatgcc
atggatgtgtcacagccaaacaactggccgcgcgtggaagagctgttccgccgcaaggta
tggcgtctggtggacctgggctacgcggcggtgacggatgagaccactaaagcgaccatg
cgagagctgaaagcggtgggatatacctctgagccgcacgcggcaattgcgtatcgcgca
ctgcgcgaccagctcaacccgggggaatatggtctgttcctcggtaccgcccatcccgcc
aagttcaaagagagcgtggaagcgatcctgggcgaaacgctgccgctgccaaaagagctg
gccgagcgtgccgacctgccgctgttgtcacacgagctgcctgcggattttgccgcgctg
cgtaagctgatgatgactcgcgcgtga

DBGET integrated database retrieval system