KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_04315Help
Entry
ECENHK_04315      CDS       T02315                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:eno00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938536..939735
Genome map
AA seq 399 aa AA seqDB search
MKHLTLLGSTGSIGCSTLDVVRHNPEHYTVTALVAGKNVQRMVEQCLEFMPRYAVMDDDE
SARQLKTLLLEKGSRTEVLSGAQAACDMAALDEVDQVMAAIVGAAGLLPTLAAIDAGKDV
LLANKESLVTCGRLFMDAVKQRGARLLPVDSEHNAIFQSLPQPFQQNLGYADLEQNGVVS
ILLTGSGGPFRETPLSELSAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAKQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVKSGVKPLDFC
KLSSLTFSEPDYDRYPCLKLAMNAFDQGQAATTALNAANEITVDAFLHQQIRFTDIATLN
LSVLEIMDLREPQSVEEVLAVDAAARDIARKQVSRLASW
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatttaactctccttggctcaaccggctctatcggttgcagtactctcgacgtc
gtccgccacaatcctgaacattataccgtgaccgcgctggtcgccggtaagaacgtgcag
cgcatggtcgagcagtgcctggagtttatgccacgttatgcggtgatggatgacgatgag
agcgcgcgtcagctgaaaactctgctgcttgagaagggcagtcgaaccgaggtgctgagt
ggggcgcaggcggcctgcgacatggcggcgctggatgaggttgaccaggtcatggcggcc
attgtcggtgcggccgggttgctgccgacgcttgcggcaatagatgcgggtaaagatgtt
ctgctggccaacaaagagtcgctggtgacctgtggacgtctgtttatggacgcggtgaag
cagcgcggggcgcgtcttttgccggtcgacagcgagcacaacgccatttttcagagttta
ccgcaaccttttcaacagaacctggggtacgctgacctggagcagaatggcgtcgtgtcg
attctgcttaccgggtctggtggcccgttccgtgaaacgccactgtctgaactgagcgca
atgacgccggatcaggcgtgtcgtcatccgaactggtcaatgggacgtaaaatctccgtt
gactccgccaccatgatgaacaaaggtctggaatacattgaagctcgctggctgtttaat
gcgtcagcgaaacagatggaagttctgattcacccgcaatctgtcattcactcgatggtg
cgctatcaggatggcagcgtgctggcacagctgggcgagccggatatgcgtacgcccatc
gcccatacaatggcgtggccaaaccgggtgaaatcgggcgtgaagccgcttgatttttgt
aagctaagttccctgacgttcagtgaacccgattacgatcgctatccttgtctgaagctt
gcgatgaatgccttcgaccagggacaggcggcgacgacggcactgaatgcagccaacgaa
attaccgttgacgcatttctgcatcagcaaatccgctttaccgatatcgcaacgttgaat
ttatcggtactggaaataatggatttgcgtgagcctcaaagtgtggaagaggtgctggcg
gtcgatgctgctgcacgtgatattgcgcgtaaacaggtgagccgcctcgcaagctggtga

DBGET integrated database retrieval system