KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_04630Help
Entry
ECENHK_04630      CDS       T02315                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00330  Arginine and proline metabolism
eno00332  Carbapenem biosynthesis
eno01100  Metabolic pathways
eno01130  Biosynthesis of antibiotics
eno01230  Biosynthesis of amino acids
Module
eno_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECENHK_04630
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ECENHK_04630
Enzymes [BR:eno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ECENHK_04630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFP68813
Position
1009273..1010376
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPEAELITDVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGSRPG
VIGDVMEGISVGTRFHAQESPLENRKRWIFGAPPAGELTVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRIRNLEGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggtaccagtgtgttaacaggcggatcg
cgccgcctaaatcgcgcccacattgttgagcttgtacgtcagtgcgctcaactgcatgcc
gcagggcatcgtattgtgattgtgacttccggggcgattgccgccgggcgtgaacatctg
ggttaccccgaactccccgcgacgatcgcctctaaacagctgctggccgccgtgggacaa
agccgactcattcaactctgggaacagctgttctccatctacggtattcacgtcgggcag
atgctgctgacgcgcgcggatatggaagacagagagcgcttcctgaacgcgcgcgatacc
ctgcgcgcgctgctggacaacaacattgttcccgtcatcaacgaaaacgatgccgttgcc
accgctgaaatcaaagtgggggataacgataatctctctgcgctggccgccattctggcc
ggtgctgataaactcctgcttctgaccgatcagcaagggctgtttaccgcagatccgcgc
tccaacccggaagccgaactgatcaccgacgttcatggcatcgacgatgcgctgcgtgcc
atcgccggtgacagcgtttcagggctgggaaccggtggtatgggaaccaagctgcaggct
gctgacgtggcgtgccgtgccggtatcgacaccattattgcggcgggcagccgcccgggc
gtgattggtgacgtgatggaaggcatctctgtcggcacccgcttccacgcgcaggaatcc
ccgctggaaaaccgcaagcgctggatatttggcgcgcctcctgccggtgagctcaccgtt
gatgaaggcgcgacggcggcgattctggaacgagggagttcattgcttcctaaaggaatt
aaaagcgtgacaggcaacttctcccgtggtgaagtgatccgcatccgtaaccttgaaggt
cgcgatatcgcccatggcgtaagccgctataacagcgacgcgctgcgccgcattgcgggc
caccattcgcagcagatcgacgccattctgggctatgaatatggcccggttgccgttcac
cgcgatgacatgattattcgttaa

DBGET integrated database retrieval system