KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_06185Help
Entry
ECENHK_06185      CDS       T02315                                 

Definition
(GenBank) hypothetical protein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00270  Cysteine and methionine metabolism
eno01100  Metabolic pathways
Module
eno_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECENHK_06185
Enzymes [BR:eno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     ECENHK_06185
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     ECENHK_06185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AFP69120
Position
complement(1341298..1341840)
Genome map
AA seq 180 aa AA seqDB search
MSALTVYSDKDASQPKWHSTDAAEIARQLNAKGVRFERWDADRDLGQDPAPEAVIEAYQH
AIDKLVAEKGYQSWDVISLRADNPQKDALRAKFLSEHTHGEDEVRFFVEGAGLFCLHIGD
EVYQVLCEKNDLISVPAGTPHWFDMGSEPNFTAIRIFDNPEGWVAQFTGDAIADAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaactgtctattctgataaagacgccagtcaaccaaagtggcacagcacc
gacgccgccgagatcgcccggcagctcaacgccaaaggcgtacgttttgaacgctgggac
gcggaccgcgatttaggtcaggatcccgccccggaggcggtgattgaggcttaccagcat
gcgatcgacaaactggtggcagagaaaggttatcagagctgggacgtcatcagcctgcgg
gccgataacccacaaaaagacgcgctgcgcgcaaagttcctgagcgaacatactcacggc
gaagacgaagtgcgcttcttcgtggaaggcgcgggattgttctgcctgcacattggcgat
gaggtttatcaggtgctgtgcgagaaaaacgatctgatctccgtacccgcgggtacgccg
cactggtttgatatgggttcagagccgaactttaccgcgatccgtattttcgacaatccg
gaaggctgggtggcgcagtttacgggcgatgcgatcgcggatgcgtatccacgtctggca
taa

DBGET integrated database retrieval system