KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_06600Help
Entry
ECENHK_06600      CDS       T02315                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00020  Citrate cycle (TCA cycle)
eno00190  Oxidative phosphorylation
eno00650  Butanoate metabolism
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
eno01130  Biosynthesis of antibiotics
eno01200  Carbon metabolism
Module
eno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eno_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECENHK_06600 (sdhD)
   00650 Butanoate metabolism
    ECENHK_06600 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECENHK_06600 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFP69203
Position
1428960..1429307
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMIGFFATSGTLTWEIWSGFFGSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAIRLPLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaacggcgtacatgacttcattcttgtccgt
gctaccgccatcgttctcaccctttacatcatctatatgattggtttcttcgcgaccagc
ggtacgctgacgtgggaaatctggagtgggttcttcggatccgccttcaccaaagtgttc
accctgctggcgctgttctccatccttattcatgcgtggattggtatgtggcaggtgttg
accgattacgttaaaccgctggcgattcgccttcctctgcagctggccattgtcgttgca
ctggtggtttacgttatttatggattcgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system