KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_06620Help
Entry
ECENHK_06620      CDS       T02315                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECENHK_06620
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECENHK_06620
  Amino acid metabolism
   00310 Lysine degradation
    ECENHK_06620
Enzymes [BR:eno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECENHK_06620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434866..1436089
Genome map
AA seq 407 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV
LEDEGTTVTSRQILGRLREGNSAGKESSAKSEEKASTPAQRQQASLEEQSNDALSPAIRR
LLAEHSLDPAAIKGTGVGGRLTREDIDKHLAKAPAQAEAKAPAAAPAAAQPALGARSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSFY
VKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKN
IKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
DGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgaatctgtagcagatgcgaccgtc
gctacctggcacaaaaaaccaggcgatgccgttaagcgcgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcttcggcggatggcgtactggacgcggtg
ctggaagatgaaggtacgaccgttacctctcgtcagatcctgggtcgcctgcgtgaaggc
aacagcgcgggtaaagagtccagcgccaagtctgaagagaaagcctctacgccggctcag
cgccagcaggcttctctggaagaacagtctaacgacgccctcagcccggcgatccgtcgc
ctgctggctgaacatagccttgacccggctgccatcaaaggcaccggtgtgggtggccgt
ctgacgcgtgaagacatcgacaagcacctggcgaaagcacctgctcaggcagaagcgaaa
gcccctgcggcagcgccagcagcagctcagcctgctctgggtgcccgcagcgaaaaacgc
gtcccaatgacgcgcctgcgtaagcgcgtggccgagcgtctgctggaagcgaaaaactcc
accgcgatgctgaccactttcaacgaagtgaacatgaagccaatcatggacctgcgtaag
cagtacggtgacgcgtttgaaaaacgtcacggtatccgtctgggctttatgtccttctac
gtgaaggctgtcgttgaagcgctgaaacgctacccggaagtgaacgcgtccatcgatggc
gatgacgtggtttaccacaactatttcgacgtcagcatggcggtttctactccacgtggt
ctggtcaccccggttctgcgtgatgtggataccctgggtatggctgacatcgagaaaaat
atcaaagagctggctgttaaaggccgcgacggcaagctgaccgtagacgacctgaccggc
ggtaacttcaccattaccaacggcggcgtattcggctcgctgatgtctaccccgatcatt
aacccgccgcagagcgcgatcctgggtatgcatgccattaaagatcgtccgatggcggta
gacggtaaagttgagatcctgccaatgatgtacctggcgctctcttacgatcaccgcctg
atcgacggccgcgagtccgtgggcttcctggttgccattaaagagctgctggaagatcca
acgcgtctgctgctggacgtctag

DBGET integrated database retrieval system