KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_08920Help
Entry
ECENHK_08920      CDS       T02315                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECENHK_08920
Enzymes [BR:eno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ECENHK_08920
    3.5.1.-  
     ECENHK_08920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1917461..1918102)
Genome map
AA seq 213 aa AA seqDB search
MTQRALLLVDLQNDFCAGGALAVAEGDSTVDVANTLIDWCKARGEAVVASQDWHPANHGS
FASQHNVEPFTQGELDGLAQTFWPDHCVQQTEGAALHPLLNQKAIDAVFHKGENPTIDSY
SAFFDNGHRQKTALDAWLRHHEITELIVLGLATDYCVKFTVLDALQSGYTVSVITDGCRG
VNIHPQDSAQAFMEMAAEGATLYTLADWLETQA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacgcgccctgctactggtcgatttgcaaaatgatttctgcgcaggcggcgcg
ctggccgtcgccgaaggtgacagcaccgttgacgtggcgaatacgctgattgactggtgt
aaagcccgcggtgaagcggtggtcgccagccaggactggcacccggctaaccacggcagt
tttgccagccagcacaacgtcgaaccgttcactcagggtgaactcgacgggctggcgcaa
accttctggccggatcattgcgtgcagcaaacggaaggcgcggcgctgcatccgctcctg
aatcagaaagccatcgacgcggtgttccataagggtgaaaacccgacaatagatagctac
agcgcgttttttgataacggtcatcgtcagaagaccgcgctggacgcgtggttacgccac
catgaaatcacggagctgattgtgcttgggctggcgacagattattgcgtgaagtttacc
gtactggacgcgctccagtcaggctacaccgtcagcgtgatcaccgacggctgccgcggg
gtgaacattcaccctcaggacagcgctcaggcgtttatggagatggctgccgaaggcgcg
acgctgtataccctggcagactggctggaaacgcaggcgtag

DBGET integrated database retrieval system