KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_09640Help
Entry
ECENHK_09640      CDS       T02315                                 

Definition
glutathionine S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eno00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2062562..2063167)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFLAINPKGQVPALLLDDG
TLLTEGVAIMQFLADNVPDRQLLAPTGSIARYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTLRALLEKKLQYVNASLKDDQWICGSRFTIADAYLFTVLRWARAVKLNMEGLDHITS
YMTRMAERPAVAAALKAEGLS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcgtgctctcttgcttcccatatcaccctgcgcgag
agcggcaaagatttcacgctcgatggcgttgatctgatgaaaaagcgtctggagaatggt
gatgatttccttgccattaacccgaagggacaagttccagcgctgttgctggatgacgga
actctgctgacagaaggcgttgccatcatgcaattcctggcggacaacgtaccggatcgc
cagcttcttgcccccaccggcagcattgcacgttataagaccctggagtggttaaactat
atcgctaccgagttacataaaggctttactcccctgttccgcccggatacgccggaagag
tacaaaccgaccctgcgcgcgcttcttgagaaaaagctgcagtatgtaaacgcgtcgctg
aaagacgatcagtggatttgtggttcccgtttcacgattgccgatgcctatctgtttacc
gtgctgcgctgggcgcgggcggttaagctcaatatggaagggttagaccatattacatcg
tatatgacccgtatggcggagcgccctgctgtggctgcggcgctgaaagcggaaggtctt
agctaa

DBGET integrated database retrieval system