KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_10330Help
Entry
ECENHK_10330      CDS       T02315                                 

Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00071  Fatty acid degradation
eno00280  Valine, leucine and isoleucine degradation
eno00281  Geraniol degradation
eno00310  Lysine degradation
eno00360  Phenylalanine metabolism
eno00362  Benzoate degradation
eno00380  Tryptophan metabolism
eno00410  beta-Alanine metabolism
eno00627  Aminobenzoate degradation
eno00640  Propanoate metabolism
eno00650  Butanoate metabolism
eno00903  Limonene and pinene degradation
eno00930  Caprolactam degradation
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
eno01130  Biosynthesis of antibiotics
eno01212  Fatty acid metabolism
Module
eno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECENHK_10330
   00650 Butanoate metabolism
    ECENHK_10330
  Lipid metabolism
   00071 Fatty acid degradation
    ECENHK_10330
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECENHK_10330
   00310 Lysine degradation
    ECENHK_10330
   00360 Phenylalanine metabolism
    ECENHK_10330
   00380 Tryptophan metabolism
    ECENHK_10330
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECENHK_10330
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECENHK_10330
   00281 Geraniol degradation
    ECENHK_10330
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECENHK_10330
   00627 Aminobenzoate degradation
    ECENHK_10330
   00930 Caprolactam degradation
    ECENHK_10330
Enzymes [BR:eno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECENHK_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFP69937
Position
2207023..2207790
Genome map
AA seq 255 aa AA seqDB search
MSELTVTRHGRVLQLTLNRPAARNALNNALLTQLADALESAAVDADISACVIYGNERCFA
AGADLNEMAEKDLPATLNDIRPQLWARINAFNKPLIAAVNGFALGAGCELALLCDVVIAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLTGESITAQQAMSAGLVSDVFPA
SLTLEYALKQAAVMARHSPLALQAAKQALRQSQEVPLQAGLMQERQLFTLLSATEDRREG
IDAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgactgttacccgtcatggccgcgtgctgcagctgacgctgaaccgtccg
gcggcgcgtaatgccctgaataacgccctgttgacgcaattagccgacgcgctggaaagc
gctgcggttgatgccgacatctcggcctgtgtgatctacggcaacgaacgctgctttgcc
gccggggccgatctcaacgaaatggcagagaaagacctgccagccaccctgaacgatatc
cgcccgcaactgtgggcgcgcattaacgcgtttaacaaaccgctgatcgccgccgtcaac
ggtttcgcgctgggcgccggatgtgaacttgcgctgctgtgcgacgtggtgattgccggg
gataacgcacgatttggcctgccggaaatcaccctaggcattatgccgggggcgggcggt
acccagcgactgatccgcagcgtcggtaaatcccttgccagcaaaatggtgctgaccgga
gagagcattactgcgcagcaggcgatgagcgccgggctggtcagcgatgtcttcccggca
tccctgacgctggagtatgccctgaagcaggcggcagtgatggcgcgccattccccgctg
gcgctgcaggcggcgaaacaggcgcttcgccagtctcaggaggtgccactgcaggctggc
ctgatgcaggagcgccagctttttacgctgctctctgccaccgaagaccgccgggaaggt
atcgacgctttcttgcaaaaacgcacccccgactttaaaggacgctaa

DBGET integrated database retrieval system