KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_11405Help
Entry
ECENHK_11405      CDS       T02315                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECENHK_11405
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECENHK_11405
  Lipid metabolism
   00071 Fatty acid degradation
    ECENHK_11405
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECENHK_11405
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECENHK_11405
   00626 Naphthalene degradation
    ECENHK_11405
Enzymes [BR:eno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECENHK_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2442895..2443905
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVNVTEKTLRPLKHGEALLEMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVKEIGPGVTSLKVGDRASVAWFFEGCGHCEYCNTGNETLCRDVKNAGYSVDGGMAEE
CIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKISGIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIALDVNDEQLKLAASMGADLTINSRSEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTMRPIEDINVIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctgttgttactcaggatcatcaggttaacgttaccgaaaaaaccttgcgc
ccgctcaagcacggggaagccctgctggagatggaatgctgtggcgtatgccataccgat
cttcacgtaaagaacggtgactttggcgataaaaccggggtgatcctgggccatgaaggg
attggcatcgtcaaagaaatcggccctggcgtgacgtcgctgaaggtcggcgatcgcgca
agcgtagcctggttctttgagggctgtggtcactgtgaatactgtaataccggcaacgaa
accctgtgccgcgatgtaaaaaatgccggttactccgttgatggcggcatggcggaagag
tgcatcgtcaccgccgattacgcggtaaaagtaccggacggtctggattcggctgccgcc
agcagcatcacctgcgccggtgtcaccacttacaaagcggtgaagatctcgggtattaaa
ccgggccagtggattgccatttatggtctgggtgggctgggcaacctcgcgctgcaatat
gctaaaaacgtctttaacgccaaagtcatcgcgctggatgttaatgacgaacagctgaag
cttgccgccagcatgggtgcggatttgaccatcaactcccgcagtgaagatgccgctaaa
attgtgcaggaaaaaaccggcggcgcacatgctgctgtcgtcactgccgtcgcaaaagcg
gccttcaactccgcggtagatgccgtgcgcgccggtggtcgtgtggtcgcggttggtctg
ccaccggaagcgatgagcctggatattccgcgcctggtgctggacggcattcaggtggtg
ggttcactggttggtacccgtcaggatctgcaggaagcgttccagtttgcggcggaaggt
aaagtggtaccgaaggtgacaatgcgtccaatcgaagatatcaacgtcatcttcaaagag
atggaacagggtcagatccgtggccgtatggtgattgatttacgctcataa

DBGET integrated database retrieval system