KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_12210Help
Entry
ECENHK_12210      CDS       T02315                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECENHK_12210
Enzymes [BR:eno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ECENHK_12210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2602126..2603811)
Genome map
AA seq 561 aa AA seqDB search
MNAKIKKLINHIYGESFSDAHLDVLLSKLEQAAIDITEKRKSGWDEKDVVLITYADQFSA
KGEKALPVFTRFYNEWLARTFSHVHLLPFYPWSSDDGFSVIDYHSVAPETGSWQDVAELK
QSASLMFDFVCNHMSAKSEWFANYLAQKPGFDDFFISVDPETDLSAVTRPRALPLLTPFK
LHDGSVRHLWTTFSDDQIDLNFASPQVLIAMVDVLLHYLAEGARYIRLDAVGFMWKIPGT
SCIHLEQTHCLIQLFRAITDDVAPGTVIITETNVPHKDNISYFGDGENEAQMVYQFSLPP
LVLHAVHRQDVKALCQWAGSLALPSTKTTWFNFLASHDGIGLNPLRGILTESEILSLVEK
LQQEGALVNWKNNPDGTRSPYEINVTYLDALSSQDSPDDERIARFILAHAVLLSFPGVPA
VYIQSILGSRNDYEGVERLGYNRAINRKKYTAGQVDLELNNKQSIRHKIYSRLSEFIAIR
RGERAFHPDAQAMFESLDEQILKIVRVADNGERITALFNFSHNVHTVYEKVLSGVELLSG
QAIDGTELTLNPWQVMWIKEN
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcaaaaattaaaaaacttatcaatcatatctacggtgaatcattttctgacgca
catttagacgtgttattatcaaagcttgagcaagccgctattgatattacagaaaagcgc
aaatcaggctgggatgaaaaagatgttgtcctgattacttacgccgatcagttctccgcg
aaaggggagaaagcgttgccggtgtttacccgcttttataatgaatggcttgcccgcacg
ttttcccatgtccatcttttacctttttatccgtggtcctctgatgacggattttccgtt
attgattaccacagcgtcgcgcctgaaaccggaagctggcaggatgttgctgaattaaaa
cagtctgccagcttaatgtttgacttcgtgtgcaaccatatgtcagcaaaaagtgaatgg
tttgctaattatcttgcgcagaagccgggctttgacgatttctttatttctgtcgatcct
gaaactgatttatctgccgtgacgcggcctcgtgcattaccgctgctgacgccatttaag
ctgcatgatggaagcgtgcgtcatctttggaccacgttcagtgatgaccagatcgatctc
aacttcgcctcgcctcaggtactgattgcgatggttgacgtactgctccattacctggcg
gaaggggcgcgttacattcgcctcgacgccgttgggtttatgtggaagatcccaggcacc
agctgcatccatcttgagcagacacactgccttatccagcttttccgtgcgattaccgac
gatgtggcacccggcacggtgatcattaccgagacaaacgtcccgcataaagacaatatc
tcgtacttcggtgatggtgaaaatgaagcccagatggtctatcagttctccttgccaccg
ctggtgctgcatgctgttcatcgtcaggatgtaaaagcgctttgccagtgggcggggtcg
ctggcgctgccttcaacaaaaacgacctggttcaacttcctggcgtctcatgacggtatc
ggcctgaacccgttacgcggcattcttacggagtcagaaatactgtcactggttgaaaaa
cttcagcaggaaggggcgctggttaactggaaaaataatcctgacggaacgcgcagtcct
tacgaaatcaatgtgacctatctggacgcattaagctcgcaagacagcccggatgatgaa
cgtattgcgcggtttattctggcgcatgctgtactgctgagtttcccgggtgtacctgcc
gtatatattcaaagcattcttggctcgcgtaacgattatgaaggcgttgaacgcctcggc
tataaccgcgcgataaaccgcaagaaatacaccgccggtcaggttgaccttgagctcaat
aataaacaaagcattcgccataaaatttattcccgtttaagcgagtttattgctattcgc
cgtggggaacgcgcatttcatcctgatgctcaggcaatgtttgaatcacttgatgaacag
attcttaaaattgttcgcgtggctgataatggtgaaagaattaccgcgctatttaatttt
agtcataacgttcataccgtttacgagaaagtgctttccggtgtggaattgctatcagga
caggctattgacggtacggaactgaccctcaatccatggcaggttatgtggattaaagaa
aactaa

DBGET integrated database retrieval system