KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_12665Help
Entry
ECENHK_12665      CDS       T02315                                 

Definition
lysozyme from lambdoid prophage DLP12
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Brite
Enzymes [BR:eno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECENHK_12665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2685294..2685803)
Genome map
AA seq 169 aa AA seqDB search
MKSIVKRCSVAAVLALAALMPDFRLLNTSPEGLALIADLEGCRLTPYQCSAGVWTSGIGH
TAGVVPKGEITERQAAANLVADVLNVEKRLAVCVPVEMPQHIYDALVSFSFNVGTGAACR
STMVAYIKRHQWWQVCDQLPRWVYVNGEINKGLENRRARERAYCLRGIQ
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcaatcgttaaacgttgcagtgtggccgccgtgctggcgctggctgcgctgatg
cctgactttcgtctgcttaacacctcgcccgaggggctggcgctgattgccgacctcgaa
ggatgtcgcctgacgccttaccagtgcagcgcgggagtgtggacgtcaggcatcggccac
actgcaggcgtcgtgccgaaaggggaaatcaccgaacgtcaggcggcggcgaaccttgtc
gcggatgtgctgaacgtcgagaagcgtctcgcagtctgcgtgccggtggaaatgccgcag
cacatttacgacgcgctggtcagcttctcattcaacgtgggaaccggtgcggcctgccgg
tcgacgatggtcgcctatatcaagcgtcatcaatggtggcaggtgtgcgaccagctcccc
cgctgggtttacgtgaatggcgaaattaacaaagggctggaaaatcgtcgcgcgcgcgag
cgtgcctactgcctcagggggattcaatga

DBGET integrated database retrieval system