KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_12810Help
Entry
ECENHK_12810      CDS       T02315                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECENHK_12810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECENHK_12810
   00620 Pyruvate metabolism
    ECENHK_12810
   00650 Butanoate metabolism
    ECENHK_12810
  Lipid metabolism
   00071 Fatty acid degradation
    ECENHK_12810
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECENHK_12810
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECENHK_12810
   00626 Naphthalene degradation
    ECENHK_12810
Enzymes [BR:eno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECENHK_12810
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECENHK_12810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2712230..2714908
Genome map
AA seq 892 aa AA seqDB search
MAVTNIAELNALVERVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGKELKAVQDIILKNGALNAAIVGQP
AYKIAELAGFTVPATTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAHFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKASGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMEMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYNEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFKEGDVAAVKTEAPVIKADKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatatcgctgaactgaacgccctcgtcgagcgcgttaaaaaagcccag
cgtgaatatgccaatttcacccaagaacaggttgataaaatcttccgcgctgccgctctg
gctgctgcagatgctcgaatccctctcgctaaaatggccgttgccgaatctggcatgggt
atcgttgaagataaagtgatcaaaaaccactttgcttcagagtatatctacaacgcctat
aaagatgagaaaacctgtggcgtgctgtctgaagacgacaccttcggcacgatcaccatc
gctgaacctatcggtattatctgcggtattgttccaacgactaacccaacttcaacggct
atcttcaaatctctgatcagcctgaagacccgtaacgcaattatcttctctccacatcca
cgtgcaaaagatgcgaccaacaaggcagcagatatcgttctgcaggctgcgattgccgca
ggcgcaccaaaagatctgattggctggatcgaccaaccttccgttgagctgtccaacgca
ctgatgcaccatcctgacattaacctgatcctggcgaccggtggtcctggcatggttaaa
gctgcatacagctccggtaaacctgccatcggtgttggcgcgggtaacacccctgttgtt
atcgacgaaactgctgatatcaaacgtgccgttgcttccgtactgatgtctaaaaccttc
gataacggcgttatctgtgcatctgaacagtctgttgttgtggttgattccgtatacgac
gctgtacgcgagcgtttcgccagccacggcggctacatgctgcagggtaaagagctgaaa
gcggttcaggacatcattctgaaaaatggcgcgctgaacgccgctatcgtaggtcaaccc
gcctataaaattgctgaactcgcaggctttactgttccggcaaccaccaagatcctgatc
ggtgaagtaaaagttgtcgacgaaagcgagccgtttgctcacgaaaaactgtctcctacg
cttgccatgtaccgtgcgaaagatttcgaagacgcggtagagaaagccgagaaactggtt
gccatgggcggtatcggtcacacctcttgcctgtacaccgaccaggataaccagcctgag
cgtgttgctcacttcggtcagatgatgaaaactgcccgtatcctgattaacacccctgct
tctcagggtggtatcggtgacctgtacaacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctctctgccaatcgcgctggatgaagtgattactgatggccacaag
cgtgcgctcatcgtgactgaccgtttcctgttcaacaacggctacgctgaccagatcacc
tctgttctgaaagcgtctggcgttgaaactgaagtgttctttgaagttgaagctgaccca
acactgagcgtggtgcgtaaaggtgctgaactggcgaactccttcaaaccagatgtgatt
atcgctctgggtggtggttccccaatggatgccgcgaaaattatgtgggttatgtacgaa
catccagaaacccacttcgaagaactggcgctgcgctttatggacatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
acgggttcagaagttacgccatttgcagtagtaactgacgatgcaaccggtcagaaatac
ccactggctgactacgccctgaccccagatatggctatcgttgatgccaacctggttatg
gaaatgccgaaatcactgtgtgccttcggtggtctggatgccgtgactcacgctctggaa
gcttacgtttctgttctggcatctgagttctctgacggtcaggctctgcaggcactgaaa
ctgctgaaagaaaacctgccagcgtcttacaacgaaggttctaagaaccctgtagcgcgc
gaacgtgtccacagtgcagccactatcgccggtatcgcgtttgcgaacgccttcctgggt
gtttgccactctatggcgcacaaactgggttcacagttccacattcctcacggtctggcg
aacgccctgttgatcagcaacgttatccgttataacgccaacgacaacccaaccaagcag
acggctttcagccagtacgaccgtccgcaagcgcgccgtcgttatgctgaaatcgctgac
caccttggtctgagcgcaccgggcgaccgcactgctgcgaagattgagaaactgctggca
tggctggaaagcctgaaagctgagctgggtattcctaaatctatccgtgaagcaggcgtt
caggaagctgacttcctcgctcacgtagacaagctgtctgaagatgcattcgatgaccag
tgtactggtgctaacccgcgctacccactgatctccgagctgaaacagattctgctggat
acctactacggtcgtgagttcaaagaaggtgacgttgctgctgtgaaaacagaagcacct
gtcattaaagctgacaagaaagcgaagaaaagcgcttaa

DBGET integrated database retrieval system