KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_12825Help
Entry
ECENHK_12825      CDS       T02315                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00040  Pentose and glucuronate interconversions
eno00052  Galactose metabolism
eno00500  Starch and sucrose metabolism
eno00520  Amino sugar and nucleotide sugar metabolism
eno01100  Metabolic pathways
eno01130  Biosynthesis of antibiotics
Module
eno_M00362  Nucleotide sugar biosynthesis, prokaryotes
eno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECENHK_12825
   00052 Galactose metabolism
    ECENHK_12825
   00500 Starch and sucrose metabolism
    ECENHK_12825
   00520 Amino sugar and nucleotide sugar metabolism
    ECENHK_12825
Enzymes [BR:eno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECENHK_12825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFP70422
Position
complement(2716752..2717660)
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVM
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIKRFDETGSSQIMVEPVDDVTAYGV
VDCKGVNLEPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSAEIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGEEFKAWLNESMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagtcagaaaggccgtcatcccggtagcgggattggggacc
aggatgttaccagcaactaaggcgattcctaaagagatgttgcctctggttgataagcca
ttaattcagtatgtcgtcaatgagtgtattgcagccggcatcactgaaattgtgctggtt
acgcattcatcaaaaaactctatcgaaaaccacttcgatacaagttttgaactcgaagcc
atgctggaaaaacgtgttaagcgtcagctgttagaagaagttcagtctatttgccctccg
cacgtcaccattatgcaggtgcgtcaggggctggctaaaggcctgggtcacgcggtgatg
tgtgcacacccggttgtcggtgatgagccggtagcggttattctgcctgacgttattctg
gatgaatacgaatccgatctttcccaggacaacctggcagagatgatcaagcgtttcgat
gaaacgggtagcagccagatcatggttgagcctgttgatgacgtgacggcttacggcgtg
gttgactgcaaaggcgttaaccttgaaccaggcgaaagcgtacccatggttggcgttgta
gagaagcctaaagccgacgtagcgccttctaatctggcggttgtgggtcgctatgtcctg
agtgctgaaatctggcctctgctggcgaaaacgcctccaggcgcaggggatgaaatccag
ctgaccgatgctatcgatatgctgatcgagaaagagaccgttgaggcttaccatatgaaa
ggtaagagccatgactgcggtaataagctcggttatatgcaggctttcgttgaatatggc
attcgccacaattcactgggtgaagaatttaaagcctggctcaatgagagtatgggtatt
aagaaataa

DBGET integrated database retrieval system