KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_13685Help
Entry
ECENHK_13685      CDS       T02315                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eno00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECENHK_13685 (ruvA)
Enzymes [BR:eno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ECENHK_13685 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2900634..2901248)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIIIEKQPPLVLLEVGGVGYEVHMPMTCFYELPDAGKEAIVFTQFVVREDAQLL
YGFNNKQERTLFRELIKTNGVGPKLALAILSGMSAPQFVNAVEREDPAALIKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPATDLVLTSSGAPSTDDDAEQEAVAALVALGYKPQEASR
MVSKIAKPDASSETLIREALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgttagtgctgctggaa
gtgggtggcgttggctatgaagtccacatgccaatgacctgcttctacgagctgccggac
gcgggtaaagaggcgattgtctttacacagttcgtggtgcgtgaagatgctcagttgctt
tacggcttcaacaacaagcaggaacgtactctgttccgcgagctgattaaaaccaacggc
gtggggccgaagctggcgctggcgattttgtccggtatgtctgctccgcagttcgtgaat
gccgttgagcgcgaagatcctgcggcgctgattaaactcccggggattggtaagaaaacc
gccgagcgtctgattgttgagatgaaagaccgctttaaaggtctgcatggcgatctgttc
accccagccaccgatctggttctgacgtcatctggggcgccgtcaacagatgatgacgct
gagcaggaagcggttgccgcgctggtggcgctgggctataaacctcaggaggccagtcgg
atggtaagcaaaattgccaaaccggatgccagcagtgaaaccctgattcgtgaagcgctg
cgcgctgcattgtga

DBGET integrated database retrieval system