KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_14025Help
Entry
ECENHK_14025      CDS       T02315                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECENHK_14025
Enzymes [BR:eno01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     ECENHK_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2970824..2971810)
Genome map
AA seq 328 aa AA seqDB search
MSLQNLTRFPRLEFIGAPTPLEYLPRFSDYVGRDIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTRAENYLTNGNRLLLD
LFNVQVEMVDALTDPTAQLDELATRLEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVSLSSVVVASGSAGTHAGLAVGLEQLMPEVELIGVTVSRSVADQKPKVVTLQQAVAE
HLALKAKADILLWDDYFAPGYGTPNEEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIT
QKRFKDEGPILFVHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacagaatttaacgcgctttccccgcctggagtttatcggcgcgccgactccg
ctggagtatctgccgcgattttctgattacgtaggacgcgatattttcattaagcgcgat
gacgtgacgccgatggcgatggggggcaacaagctgcgtaagctggagtttctggccgcg
gatgcactgcgtgaaggggcggacacgctcatcaccgccggggcaatccagtccaaccac
gttcgtcagacggcggcagtcgcggcgaagcttggtctccattgcgtggcactgctggaa
aacccaattggcacgcgggcagaaaattatctcaccaacggtaatcgtctgctgctggat
ctgtttaatgtgcaggtggagatggtcgatgcgttgaccgacccgactgcgcagctcgac
gaactggctacgcgcctcgaagcgcagggtttccgtccttatgtcatccctgtcggcggt
tcgaatgcgctgggcgcgctgggttatgtggaaagtgcgctggagatcgcgcagcagtgt
gagggggcggtgagcctctcctccgtggttgtcgcgtctggcagtgcgggcacgcacgcc
gggctggcggtggggctggagcagctgatgcccgaggtggaactgataggcgtgacggtg
tcccgcagcgttgcggatcagaagcccaaagtggtcacgttacagcaggcggtggcagag
catctggcgcttaaggcaaaagccgatattctgctctgggatgactattttgcgccgggc
tacggcacgcctaatgaagaggggatggaggcggttaaactgctggcgcgccttgagggt
atactgcttgatccggtttatacgggtaaagcgatggccgggcttatagatggcattacg
cagaaacgctttaaggatgaagggccgattttatttgtgcacaccggcggggcgcccgcg
ctgtttgcttatcatcctcatgtctaa

DBGET integrated database retrieval system