KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_14560Help
Entry
ECENHK_14560      CDS       T02315                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ECENHK_14560
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECENHK_14560
Enzymes [BR:eno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ECENHK_14560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3084655..3085203)
Genome map
AA seq 182 aa AA seqDB search
MKVIDTEISDVKIIEPVVFGDERGFFMETWQQKKFCELVCNRSFVQDNHSKSAKNILRGL
HYQTQNPQGKLVRVVSGEVFDVAVDMRKSSATFGQWIGVILSAENKRQLWIPEGFAHGFY
VLSESAEFVYKCTDYYNPQSEHSLLWNDDSIGITWPLTEGELPVLSSKDREGKPFADAVY
FD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttattgatactgaaatttctgatgtcaaaatcattgagccagttgtttttggc
gatgaacgcggtttcttcatggaaacatggcaacagaaaaagttttgtgagctggtttgt
aatcgcagcttcgtgcaggacaatcactcgaaatctgcaaagaacattttgagaggctta
cattaccagactcaaaatccgcagggtaaattagtccgcgtcgtcagtggagaagtattt
gatgttgcggtcgacatgagaaaatcatcagccactttcggacagtggatcggcgttatt
ctttccgccgaaaacaaacgacaactctggatccctgaaggctttgctcacggcttctac
gttttgtctgaaagtgcagagtttgtctataaatgcactgattattacaacccgcagtcc
gagcattctttattgtggaacgatgattctatcgggatcacatggcctcttaccgagggt
gagttacctgtgctctcatccaaggatcgagagggtaagcccttcgccgacgccgtgtat
tttgactaa

DBGET integrated database retrieval system