KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_14630Help
Entry
ECENHK_14630      CDS       T02315                                 

Definition
GalU regulator GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECENHK_14630
   00052 Galactose metabolism
    ECENHK_14630
   00500 Starch and sucrose metabolism
    ECENHK_14630
   00520 Amino sugar and nucleotide sugar metabolism
    ECENHK_14630
Enzymes [BR:eno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECENHK_14630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3101243..3102142)
Genome map
AA seq 299 aa AA seqDB search
MINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDTASADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EALETEGQVSRIVEFIEKPDQPQTLDSDLMAVGRYVLNADIWAELEKTEPGAWDRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVNYGLRNLKEGHKFRETIKKLLDTHD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgaaagcagtcattccggtagcaggcctgggcatgcatatgttgccagcc
acaaaagccattcctaaagaaatgctgccgatcgtcgacaaaccgatgattcaatacatc
gtcgacgagattgttgctgcagggatcaaagaaatcgtcctggttacgcactcgtccaag
aatgcggttgaaaaccacttcgacacctcttacgaactcgaagcgttgcttgagcagcgc
gtcaaacgccagctgctggcggaagtgcaatctatttgtccacctggcgtgaccatcatg
aacgtgcgccaggcgcagccgctggggctgggccactccatcctgtgtgcccgtccggtc
gtcggtgataacccgttcatcgttgttcttccggacatcatcattgataccgcgtctgcc
gatccgctgcgctacaacctggcggccatggtggcgcgtttcaacgaaaccggtcgcagc
caggtgctggcgaaacgcatgaagggcgatctttctgagtactctgtgattcagacgaaa
gaagcgctggagacggaagggcaggtgagccgcatcgttgagttcatcgaaaagccggat
cagccgcagacgctggactccgacctgatggcggtgggtcgttatgttctgaatgccgat
atctgggcggaactggaaaaaaccgagccaggtgcctgggaccgtattcagctgactgac
gcgattgctgagctggcgaagaagcagtctgtggatgccatgctgatgacgggtgacagc
tatgactgcggtaagaaaatggggtatatgcaggcgtttgtgaactatgggctgcgtaac
ctcaaagagggccataagttccgcgagaccattaaaaagctgctagatacgcatgactga

DBGET integrated database retrieval system