KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_15055Help
Entry
ECENHK_15055      CDS       T02315                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00790  Folate biosynthesis
eno01100  Metabolic pathways
Module
eno_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECENHK_15055
Enzymes [BR:eno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ECENHK_15055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFP70854
Position
complement(3203447..3204115)
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAALVHEALLARGLETPLRPPVEDMDNETRKSLISGHMTEIMQLLNLDLSDDSL
METPKRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDTVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGVRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactcagtaaagaagctgccctggtccatgaagccctgcttgcgcgcggtctc
gaaacgccattgcgtccgcccgttgaggatatggacaatgaaacccgtaaaagtctgatt
tccgggcatatgaccgagatcatgcaactgctgaatctcgatctgagcgatgacagtctg
atggagacgcctaagcgcatcgcgaaaatgtacgtcgacgaaattttctctggcctggat
tacgccaacttcccgaaaattaccgttatcgagaataagatgaaggtggacgagatggtc
acggtacgtgatatcacgctgaccagcacctgcgaacatcacttcgtcactatcgacggt
aaagcgaccgtggcttacatcccgaaagatacggtgattggtctgtcgaagatcaaccgt
attgtgcagttcttcgcgcagcgtcctcaggttcaggagcgtcttacgcagcagatcctg
attgccctgcaaacgctgctgggcaccaataacgtggcggtctctatcgatgccgttcac
tactgcgtgaaagctcgcggcgtacgtgatgcgaccagtgcaaccaccaccacttcgctg
ggcggtctgtttaaatcgagccagaacacccgccaggagttcctgcgcgccgtgcgtcac
cacaactaa

DBGET integrated database retrieval system