KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_15575Help
Entry
ECENHK_15575      CDS       T02315                                 

Definition
disulfide bond reductase yfcG
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECENHK_15575
Enzymes [BR:eno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ECENHK_15575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3325411..3326040
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELDYRIIRVDISKGEQFSPLFLAISPNNKIPAIIDNQP
ADGGRPLSLFESGEILLYLAEKTGKLLSGELRERHHTLQWLFWQASGLGPMLGQNHHFTA
YAPQPIPYAIERYQVETQRLYGVLNQRLEKTPWLGGDHYSIADIACWPWVNTHEKHRIDL
ASYPAVNNWFERIRTRPATERALQKIQQI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttattacgcccctaccccaaacggccataagatcaccctctttctcgaa
gaagccgaactggattacagaatcattcgcgtggatatcagcaaaggtgaacagttcagt
cctctctttctggctatctcgccgaacaataaaattccggccattattgacaatcagccg
gccgacggaggaagaccgttgagcctgtttgaatccggcgaaattttgctctatctggcg
gagaaaaccggcaaactcctgagcggggagctgcgtgaacgtcaccataccttgcaatgg
ctcttctggcaggcgagcggacttgggcccatgctgggacagaatcaccattttaccgct
tacgccccgcagcccatcccttatgcgatagaacgctatcaggtggagacgcaacgtttg
tatggcgtgctaaaccagcggctggaaaaaacgccgtggcttgggggagatcattacagc
attgccgatatcgcctgctggccgtgggtgaatacccatgaaaaacaccggattgatctc
gcgtcctacccggcggtgaacaactggtttgaacgtatccgtacccgcccggccaccgaa
cgcgcactgcaaaaaatccagcagatttaa

DBGET integrated database retrieval system