KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_15575Help
Entry
ECENHK_15575      CDS       T02315                                 

Definition
(GenBank) putative disulfide bond reductase yfcG
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Brite
Enzymes [BR:eno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     ECENHK_15575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3325411..3326040
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELDYRIIRVDISKGEQFSPLFLAISPNNKIPAIIDNQP
ADGGRPLSLFESGEILLYLAEKTGKLLSGELRERHHTLQWLFWQASGLGPMLGQNHHFTA
YAPQPIPYAIERYQVETQRLYGVLNQRLEKTPWLGGDHYSIADIACWPWVNTHEKHRIDL
ASYPAVNNWFERIRTRPATERALQKIQQI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttattacgcccctaccccaaacggccataagatcaccctctttctcgaa
gaagccgaactggattacagaatcattcgcgtggatatcagcaaaggtgaacagttcagt
cctctctttctggctatctcgccgaacaataaaattccggccattattgacaatcagccg
gccgacggaggaagaccgttgagcctgtttgaatccggcgaaattttgctctatctggcg
gagaaaaccggcaaactcctgagcggggagctgcgtgaacgtcaccataccttgcaatgg
ctcttctggcaggcgagcggacttgggcccatgctgggacagaatcaccattttaccgct
tacgccccgcagcccatcccttatgcgatagaacgctatcaggtggagacgcaacgtttg
tatggcgtgctaaaccagcggctggaaaaaacgccgtggcttgggggagatcattacagc
attgccgatatcgcctgctggccgtgggtgaatacccatgaaaaacaccggattgatctc
gcgtcctacccggcggtgaacaactggtttgaacgtatccgtacccgcccggccaccgaa
cgcgcactgcaaaaaatccagcagatttaa

DBGET integrated database retrieval system