KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_16150Help
Entry
ECENHK_16150      CDS       T02315                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eno01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eno00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3455011..3456138
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDFGDTQNFWAWRGQGET
LAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HKNRLAFLVTSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPMLSELVAIEWDKGNEFFPPTSMQIANVKAGT
GSNNVIPGDFFVQFNFRFSTELTDEMIKARVVALLEKYHLRYTVDWWLSGQPFLTQRGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgcccggtcattgagctgactcaacagcttattcgccgtccttcccttagcccg
gacgacgcaggttgtcaggcattaatgattgagcgcctgcgtgccatcggttttaccgtt
gaacgcatggattttggcgatactcagaacttctgggcgtggcgcggccagggtgaaacg
ctggcgtttgccgggcatactgacgtcgttcccgcaggtgacgcagatcgctggattaac
ccgccgtttgaaccgaccatccgcgatggcatgctctttggccgcggcgcggcagacatg
aaaggctcgctggcagcgatggtggtcgcggctgaacgcttcgtggctcagcatccgaac
cacaaaaaccgtctcgcgtttttggtcacctccgacgaagaagccagtgcccataacggt
accgtgaaggtggttgaagcgctgatggcgcgcaacgagcgtctcgactactgtctggtc
ggcgagccgtccagtaccgaagtggtgggcgatgtcgtgaaaaacggtcgccgtggctca
ctgacctgtaacctgaccattcacggcgttcagggacatgttgcttatccacatctggcc
gataaccccgttcatcgcgctgcgccaatgctgagcgaactggtggcgattgagtgggac
aaaggtaacgagttcttccccccgaccagcatgcagattgctaacgtcaaggccgggacc
ggcagcaacaacgtgatcccgggggacttcttcgtccagttcaacttccgcttcagcacc
gaactgaccgatgagatgatcaaagcgcgcgttgtcgcgctgctggaaaaatatcacctg
cgctacaccgtggactggtggctttccggccagccgttcctgacgcagcgcggcaaactg
gttgatgcggtagtgaacgccatcgagcactataatgaaattaagccacaactgctgacg
acgggtggcacttcagacggacgctttatcgcccgtatgggagctcaggttgtcgaactg
gggccagtaaacgcaaccattcataaaataaatgagtgtgttaatgcggcagatttgcaa
ctgctggctcgtatgtatcaacgtattatggagcaactcgtcgcctga

DBGET integrated database retrieval system