KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_16255Help
Entry
ECENHK_16255      CDS       T02315                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eno00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3475044..3476474)
Genome map
AA seq 476 aa AA seqDB search
MSGFKADFLWGGAVAAHQLEGGWKEGGKGVSVADVMTAGAHGVPREITNGVLEGKNYPNH
EAIDFYHRYKEDIRLFAEMGFKCFRTSIAWTRIFPKGDEREPNEAGLKFYDDLFDECLKY
GIEPVITLSHFEMPFHLVTEYGGWRNRKLIDFFVRFAKVVFQRYQHKVKYWMTFNEINNQ
ANFHEDFAPFTNSGLKYAPGEDREPVMFQAAHYELVASALAVKAGREINPSLQIGCMIAM
CPIYPLTCAPDDMMMAMNAMHRRYWFTDVHVRGKYPQHLLNYFERRGFALDITDEDKAAL
RQGCVDYIGFSYYMSFATKATADNPQLDYDESKSLVSNPYVQKSDWGWQIDPVGLRYSLN
WFWDHYQLPLFIVENGFGAIDVQESDGTVNDRYRIDYLSAHIREMKKAVVEDGVDLMGYT
PWGCIDLVSAGTGEMKKRYGFIFVDKDNEGNGTLNRSKKKSFDWYKQVIASNGEQL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaagcagattttctgtggggtggtgccgttgcggcgcatcagctggaa
ggcggctggaaagagggcggcaagggcgtaagcgttgccgacgtcatgacggcgggtgcg
catggcgtaccgcgtgaaatcaccaacggcgtgctggaagggaagaattaccctaaccat
gaagccattgatttctaccatcgttataaagaagacatcagactctttgccgagatgggg
ttcaaatgtttccgtacctccatcgcctggacgcgtatcttcccgaaaggtgacgagcgg
gagcctaatgaggctggcctgaaattctatgacgatctgttcgacgaatgcctgaagtac
ggcatcgaaccggttattacgctttctcacttcgagatgcctttccacctggtgacggaa
tacggcggctggcgcaaccgtaagctgatcgactttttcgttcgttttgcaaaagtggtc
ttccagcgctatcagcataaagtgaaatactggatgaccttcaatgagatcaacaaccag
gctaacttccacgaagattttgcgccgttcaccaactccgggttgaagtatgcgccgggt
gaagaccgtgagccggtcatgttccaggccgcgcactacgagctggtggccagcgccctg
gcggtgaaggcgggacgcgaaattaatccgtcgctgcagatcggctgcatgattgctatg
tgtcctatctatccgctgacctgcgcgccggacgatatgatgatggcgatgaatgcgatg
caccgtcgctactggtttaccgacgtgcacgtccgcggtaagtacccgcagcatctgctc
aactactttgaacgtcgcgggttcgcgctggatattaccgatgaggataaagcagcgctg
cgccagggttgcgttgattatatcggcttcagctattacatgtcctttgccaccaaggcg
acggcggacaacccgcagcttgattacgacgagagcaagagcctggtctctaacccgtat
gtgcagaaatccgactggggctggcagattgacccggttgggctgcgctactccctgaac
tggttctgggatcactaccagctgccgctgttcattgttgaaaacggctttggcgcgatt
gacgtgcaggagagtgacggcacggtaaacgatcggtaccgcattgattacctttctgcg
cacatccgcgagatgaaaaaagcggtggtggaagatggcgtagatctgatgggctacacc
ccgtggggctgtatcgaccttgtgtctgccggcaccggtgaaatgaaaaaacgctacggc
tttatctttgtagataaagacaatgaagggaacggcacgctgaaccgcagcaagaaaaag
tccttcgactggtataagcaggtgattgcgagcaacggcgagcagctataa

DBGET integrated database retrieval system