KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_17530Help
Entry
ECENHK_17530      CDS       T02315                                 

Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECENHK_17530
Enzymes [BR:eno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECENHK_17530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3743842..3745266
Genome map
AA seq 474 aa AA seqDB search
MSVFPQGFLWGGALAANQSEGAYREGGKGLTTVDMIPHGANRLAVKLGKEKRFSLRDDEF
YPSHEAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDEPLPNKEGIAFYRAVFEE
CKKYNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVDFFARYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENEDQVKYQAAHHELVASALATKIAHEVNPENQVGCMLAGG
NFYPYSCKPEDVWMALEKDRENLFFIDVQARGRYPAYSDRVFREKGVVIVKDTGDDELLK
NTVDFVSFSYYASRCASADMNAGNTSAANIVKSLRNPHIQVSEWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDVIDENGEINDDYRISYLREHIRAMGDAIEDGVPLMGYTTWG
CIDLVSASTGEMSKRYGFVYVDRDDAGNGTLDRKRKKSFWWYKKVIASNGGDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttttccacaaggatttttatggggcggcgcgcttgccgctaaccagagtgaa
ggtgcttaccgtgaaggcggcaaaggactgacgacggtcgatatgatcccccacggtgcc
aatcgtctggcggtgaagctcggtaaggaaaagcgtttttcgctgcgtgacgacgagttt
tacccgagccacgaggcgattgatttttaccatcgctataaagaagacatcgccctgatg
gcggagatgggctttacggtattccgcacctcgattgcctggagccgcctctacccgaac
ggtgacgaaccgctgccgaacaaagagggcatagccttttaccgcgcggtatttgaggag
tgcaaaaagtacaacatcgagccgctggtcacgctctgccacttcgacgtgccgatgcac
cttgtgacggaatacggctcctggcgcaaccgcaagatggtcgacttcttcgcccgctac
gcccgcacctgctttgaggcgtttgacgggctggtaaaatactggctgactttcaacgaa
atcaacatcatgctgcacagcccgttctccggtgccgggctggtgtttgaggaaggtgaa
aacgaagatcaggtaaaatatcaggccgcgcaccacgagctggtggcgagcgcactggca
accaaaatcgctcacgaggtgaacccggaaaatcaggtgggctgcatgctggcgggcggt
aacttctatccgtactcctgcaaaccggaagacgtgtggatggcgctggagaaagaccgc
gagaacctgttctttatcgacgtgcaggcacgcggccgctatccggcctactcggatcgc
gtgttccgtgagaaaggcgtggtcattgtcaaagacaccggcgatgacgagctgctgaaa
aacaccgtcgattttgtctcgttcagctattacgcctcgcgctgcgcgtcggcggatatg
aacgcgggcaacaccagcgcggcaaacatcgtgaagtccctgcgtaacccgcacattcag
gtgagcgaatggggctggggcattgacccgcttggcctgcgcatcaccatgaacatgatg
tacgaccgctaccaaaagccgctgttcctggtggaaaacggcctgggtgcgaaagatgtc
attgatgaaaacggcgagattaacgacgactaccgcatcagctatctgcgcgagcatatc
cgcgcgatgggtgatgcgattgaggacggcgtgccgctgatgggctacaccacctggggc
tgtatcgacctggtttcagcgtctaccggcgaaatgagcaaacgctacgggttcgtgtac
gttgaccgcgacgatgcggggaacggcacgctggaccggaagcgcaagaaatcgttctgg
tggtataagaaggtgattgcgagtaacgggggcgatctcgagtag

DBGET integrated database retrieval system