KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_18260Help
Entry
ECENHK_18260      CDS       T02315                                 

Definition
protein disulfide isomerase II DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Brite
Enzymes [BR:eno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ECENHK_18260
Secretion system [BR:eno02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECENHK_18260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3903987..3904700)
Genome map
AA seq 237 aa AA seqDB search
MKKSFALFTLLAASFTGFAHADDAAIKQSLAKLGVTSSDIQSAPVAGMKTVLTNSGVLYV
TEDGKHIIQGPMYDVSGAQPVNVTNQLLMKNLNALEKEMIVYKAAQEKHVITVFTDITCG
YCHKLHEQMKDYNALGITVRYLAFPRAGVQSQPEQDMKAIWCAKDRNKAFDDAMSGKEVK
PASCDIDIANHYALGVQFGVSGTPAIVLSNGYVVPGYQGPKEMKEFLDAHQKQFGGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtctttcgcgctgttcaccctgctggcagcctcttttaccgggttcgcccat
gcggatgacgccgctattaaacagtcactggctaaactgggcgttaccagcagtgacatc
cagtctgcgccggttgccgggatgaaaacggtactgactaacagcggcgtgctgtatgtc
accgaagacggcaaacatattattcaggggccaatgtatgacgtgagcggcgcgcagccg
gtcaatgtcaccaaccagctgctgatgaaaaacctgaatgcgctcgaaaaagagatgatc
gtctataaagcggcgcaggaaaaacatgtgattaccgtcttcaccgacatcacctgtggc
tactgccacaagctccatgagcagatgaaagactataacgcgctgggcattaccgtgcgt
tacctggccttcccgcgtgcaggcgtgcagagccagccagagcaagacatgaaagcgatt
tggtgtgcgaaagatcgcaacaaagcgtttgacgatgcgatgagcggtaaagaggttaag
cctgcgtcctgcgatatcgatattgctaaccactacgcgctgggcgtgcagttcggcgta
agcggtacgccagcgattgtcctgagcaatggctatgttgtgccgggttaccagggacca
aaagagatgaaagagttcctcgacgcgcaccagaaacagtttggtggtaaataa

DBGET integrated database retrieval system