KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_20765Help
Entry
ECENHK_20765      CDS       T02315                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECENHK_20765 (malQ)
Enzymes [BR:eno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ECENHK_20765 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4411023..4413101)
Genome map
AA seq 692 aa AA seqDB search
MESKRLDSAAQAAGISLSYINAHGKPQSIGADTKRRLLNAMHKADAKASALPVPNVKVFT
AGKKMSLTVEGRGEFSWLLTTEEGHQHKGHATGGKAFNLPAKLPEGYHSLTLTQDEQRFH
CRVIVAPKRCYEPQALLEGKKLWGACVQLYTLRSDSNWGIGDFGDLKNMLASVGERGGAF
IGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNALDDFKNSKDAQAWWKLETTKQML
KQAREADWVDYATVTALKMAALRLAWKGFAKRDDDQMAAFRQFVAQEGESLYWQAAFDAL
HAHQVKEDEMRWGWPVWPEVYQSVDTPEVKAFCKTHADEVDFYLWLQWLAYSQFAACWQV
SQGYNMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPH
VMAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLLSI
LALESKRHQCMVIGEDLGTVPVEIVSKLRDSGVYSYKVLYFENDHEKTFRAPKAYPEQSM
AVATTHDLPTLRGYWESGDLTLGKTLGLYPDEEVLRGLYQDRELAKQGLLDALHKHGCLP
KRAGHKASLMAMTPTLNRGLQRYIADSNSALLGLQPEDWIDMAEPVNIPGTSYQYKNWRR
KLSTTLEKMFADDGVNRLIKDLDKRRKAAAKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgtctggacagtgccgcgcaggcggcgggaattagcctcagttacatc
aatgcgcacggcaaaccgcagtctattggtgcggacaccaaaagacgtttgctgaatgcc
atgcacaaagccgacgcgaaagcgtcggcactaccggtgccaaacgtaaaggtctttact
gcgggcaaaaaaatgtcgctgacggtggaggggcgcggcgagtttagctggctgctcacc
accgaagaggggcatcagcataaaggccacgccaccggcggcaaagcgtttaaccttccg
gcgaaactgccggagggctatcacagcctgacgctcacccaggacgagcagcgttttcac
tgccgggtgatcgtcgcgccaaaacgctgctatgagccgcaggcgctgctcgaaggcaaa
aagctgtggggcgcctgcgtgcagctctacacgctgcgttccgacagcaactggggcatc
ggcgattttggcgatctgaagaatatgctggcctccgtgggtgagcgcggcggcgcgttc
atcggcctcaacccgatccacgcgctctatccggcgaacccggaaagcgccagcccgtac
agcccgtcctcccgtcgctggctgaacgtcatttatatcgacgttaacgcgttggatgat
tttaaaaacagtaaagacgcgcaggcgtggtggaagcttgagaccacgaagcagatgctg
aaacaggcccgcgaagcggactgggtcgattatgctactgtgaccgcgctaaaaatggcg
gcgctgcgtctggcctggaaaggctttgctaagcgcgatgacgatcagatggcggccttc
cgccagtttgtggcgcaggaaggcgaaagtctctactggcaggcggcattcgatgcgctg
cacgcgcatcaggtgaaagaggacgaaatgcgctggggctggccggtctggccggaagtg
taccagtccgtggacaccccggaagtcaaagccttctgtaaaacgcatgccgacgaggtg
gacttctatctgtggctgcagtggctggcctacagccagtttgccgcctgctggcaggta
agccagggctataacatgccgatcggcctgtatcgcgacctggccgtcggtgtggcagaa
ggtggcgcggaaacctggtgtgaccgtgagctttactgcctgaaagcgtccgtcggtgcg
ccgccggatatccttgggccgctcggtcagaactggggcttgccgccgatggatccgcac
gtgatggcggcgcgcgcgtacgagccgtttatcgacctgctgcgtgcgaacatgcaaaac
tgtggcgcgctgcgtattgaccacgtcatgtccgtactgcgcctgtggtggatcccttac
ggcgaaacggccgatcacggcgcgtacgtccagtatccggtagacgatctgctgtcgatc
ctggccctggagagtaagcgtcaccagtgtatggtgatcggggaagatctcggtaccgtg
ccggtggaaattgtcagcaagctccgcgacagcggcgtgtactcctataaagtgctctat
tttgaaaacgaccatgagaaaaccttccgcgcgccgaaagcgtatccagaacagtcaatg
gcagtcgcgacgacgcatgatcttcctacgctcagaggctactgggaaagcggcgatctg
acgctcgggaaaacgctgggtctctatcctgatgaagaggttctgcgtgggctgtatcag
gatcgcgagctggcgaagcaggggctgctggatgcgctgcataagcatggctgcctgccg
aagcgcgccggtcacaaggcgtcgctgatggcgatgacgccaacgctcaaccgcggtttg
cagcgctatattgccgacagcaacagcgctctgcttggccttcagccggaagactggatt
gatatggcggagccggtgaacatcccgggcaccagctatcagtacaagaactggcgtcgc
aaattgtccacaacgcttgagaagatgtttgccgatgacggggtgaacaggctgattaag
gatttggataagcggcgaaaagcggctgctaagaagtga

DBGET integrated database retrieval system