KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21055Help
Entry
ECENHK_21055      CDS       T02315                                 

Definition
(GenBank) endo-1,4-D-glucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4483709..4484815)
Genome map
AA seq 368 aa AA seqDB search
MKAFRWCAVAALMLAALPLRAACTWPAWEQFKKDYISEGGRVIDPSDTRKITTSEGQSYA
LFFALAANDRRAFEQILTWTRDNLAGGNLNDHLPAWLWGQKDKENWAVIDTNSASDADVW
IAWSLLEAGRLWKHPDYTRTGKALLKRIAGEVVVKVPGLGAMLLPGKVGFADENAWRFNP
SYLPPQLASYFTRFGAPWTTLRETNLRLLLESAPKGFSPDWVQYQKNRGWQLKQDKALVG
GYDAIRVYLWVGMMSDKDPQKARLLTRFQPMAAKTMKQGVPPEKVDVSTGKRTGNGPVGF
SAAMLPFLQQRDAQAVQRQRVADHFPDNNAYYSYVLTLFGQGWDQHRFRFTAKGDLIPDW
GQECASSQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctttcgctggtgtgcagtagcagcgttgatgctggcggcgcttcctcttcgc
gccgcctgtacctggcctgcctgggagcagttcaaaaaggattacatcagcgagggcggg
cgcgtcattgatcccagtgacacgcgcaaaattacgacgtcggaagggcaaagctatgcg
ttgttctttgctctggccgccaacgatcgccgcgcgtttgagcaaatactgacatggacg
cgcgataaccttgccggcggcaatctcaacgaccatctgcctgcctggctctgggggcag
aaagacaaagaaaactgggcggtgattgataccaactccgcctcagatgccgatgtctgg
atcgcctggtcactgcttgaagcgggccggttatggaaacatccggactacacccgcacg
ggtaaggcgctgttgaaacgcattgccggtgaggtagtggtgaaagtaccagggctcggc
gccatgctgcttccgggtaaagtcggttttgctgatgaaaacgcctggcgctttaacccc
agctatcttcctccgcagttagcaagctatttcacccgctttggtgccccgtggaccacg
cttcgtgaaacgaatctgcgactgctgctggaaagcgcgccaaaggggttctcgccggac
tgggtgcagtatcagaaaaacagaggctggcagttaaagcaggataaagcgctggtaggg
ggctacgacgctattcgtgtctatctttgggtgggcatgatgagtgataaagatcctcag
aaagcccgattgctgacgcgcttccagccgatggcggcaaaaacaatgaaacagggcgtg
ccgccggaaaaagtggacgtgtcgacgggtaaacgcaccggcaatggtccggtcgggttc
tctgccgccatgctgccgtttttacaacagcgcgatgctcaggcggttcagcgccagcgc
gttgcagaccattttcccgataacaacgcctattacagctatgtactgactctctttggt
cagggatgggatcagcatcgttttcgcttcaccgctaaaggtgacttaataccggattgg
ggccaggaatgcgcaagttcacagtaa

DBGET integrated database retrieval system