KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21095Help
Entry
ECENHK_21095      CDS       T02315                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECENHK_21095
Enzymes [BR:eno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ECENHK_21095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4494463..4495458)
Genome map
AA seq 331 aa AA seqDB search
MRKPVCATLAVMMSLLFSPLSQASQAWESYKARFFKPEGRIVDTGNGDVSHTEGQGFAML
MAVANDDKATFDKLWQWTNRTLKNSENGLFYWRYNPAESNPVADKNNATDGDVLIAWALL
KADARWHDKRYSAASDAITKALIDHNVIRYAGYRVMLPGVQGFKLEDEVVLNPSYFVFPA
WQAFAERSHLPVWRELIKDGKRLLGKMGSGKANLPTDWVSLASAGKLTAAKGWPPRMSYD
AIRIPLYIAWSDKQSPLLTPWKAWFGQFPREHTPAWVNVTTNEYAPYMMEGGLLAVRDLT
MGQPSGEPEITSKDDYYSASLKMLVWISAQQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaacccgtctgcgcgaccctggctgtgatgatgagtttgctgttctctcctctc
tcgcaggcgagtcaggcctgggagagttacaaggcgcgctttttcaaaccggaaggccgc
attgttgataccggcaacggtgacgtttcgcatacggaaggtcagggtttcgccatgtta
atggcggtggctaacgacgataaagccacgttcgataagctctggcaatggaccaacagg
acgctaaagaacagcgaaaatggtctgttttactggcgttataaccccgcggagtctaat
ccggtcgctgataaaaacaacgccacagatggcgatgtcctgattgcatgggcgttgtta
aaagccgatgcgcgctggcatgacaaacgctacagcgccgcatcggatgcgattacgaaa
gcattgattgaccacaacgtaatccgctatgcgggttaccgcgtgatgctgcccggcgta
cagggatttaagcttgaggatgaagtggtccttaatccttcctattttgtgtttccggcc
tggcaggcctttgccgaacgcagtcatttgccggtctggcgtgaattgataaaggacggg
aaacgtctgctgggaaaaatgggatcgggtaaagcgaatctaccgacagactgggtttcg
ctggcatccgcgggcaagctgacggcggccaaaggctggccaccgcgaatgagctacgat
gcgattcgtattccgctgtacatagcctggtctgataaacaaagcccgctgctgacgccc
tggaaagcctggtttggtcagttcccacgggaacatacacccgcctgggttaacgtcacg
accaatgaatacgcgccctatatgatggaaggcggtctgctggcggtcagggatttaacg
atgggtcagccatccggcgaaccggaaatcacctctaaagatgactattattcggcaagt
ctgaaaatgctggtatggatttcagcgcaacaataa

DBGET integrated database retrieval system