KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21095Help
Entry
ECENHK_21095      CDS       T02315                                 

Definition
(GenBank) endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4494463..4495458)
Genome map
AA seq 331 aa AA seqDB search
MRKPVCATLAVMMSLLFSPLSQASQAWESYKARFFKPEGRIVDTGNGDVSHTEGQGFAML
MAVANDDKATFDKLWQWTNRTLKNSENGLFYWRYNPAESNPVADKNNATDGDVLIAWALL
KADARWHDKRYSAASDAITKALIDHNVIRYAGYRVMLPGVQGFKLEDEVVLNPSYFVFPA
WQAFAERSHLPVWRELIKDGKRLLGKMGSGKANLPTDWVSLASAGKLTAAKGWPPRMSYD
AIRIPLYIAWSDKQSPLLTPWKAWFGQFPREHTPAWVNVTTNEYAPYMMEGGLLAVRDLT
MGQPSGEPEITSKDDYYSASLKMLVWISAQQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaacccgtctgcgcgaccctggctgtgatgatgagtttgctgttctctcctctc
tcgcaggcgagtcaggcctgggagagttacaaggcgcgctttttcaaaccggaaggccgc
attgttgataccggcaacggtgacgtttcgcatacggaaggtcagggtttcgccatgtta
atggcggtggctaacgacgataaagccacgttcgataagctctggcaatggaccaacagg
acgctaaagaacagcgaaaatggtctgttttactggcgttataaccccgcggagtctaat
ccggtcgctgataaaaacaacgccacagatggcgatgtcctgattgcatgggcgttgtta
aaagccgatgcgcgctggcatgacaaacgctacagcgccgcatcggatgcgattacgaaa
gcattgattgaccacaacgtaatccgctatgcgggttaccgcgtgatgctgcccggcgta
cagggatttaagcttgaggatgaagtggtccttaatccttcctattttgtgtttccggcc
tggcaggcctttgccgaacgcagtcatttgccggtctggcgtgaattgataaaggacggg
aaacgtctgctgggaaaaatgggatcgggtaaagcgaatctaccgacagactgggtttcg
ctggcatccgcgggcaagctgacggcggccaaaggctggccaccgcgaatgagctacgat
gcgattcgtattccgctgtacatagcctggtctgataaacaaagcccgctgctgacgccc
tggaaagcctggtttggtcagttcccacgggaacatacacccgcctgggttaacgtcacg
accaatgaatacgcgccctatatgatggaaggcggtctgctggcggtcagggatttaacg
atgggtcagccatccggcgaaccggaaatcacctctaaagatgactattattcggcaagt
ctgaaaatgctggtatggatttcagcgcaacaataa

DBGET integrated database retrieval system