KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21130Help
Entry
ECENHK_21130      CDS       T02315                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00071  Fatty acid degradation
eno00280  Valine, leucine and isoleucine degradation
eno00281  Geraniol degradation
eno00310  Lysine degradation
eno00362  Benzoate degradation
eno00380  Tryptophan metabolism
eno00410  beta-Alanine metabolism
eno00640  Propanoate metabolism
eno00650  Butanoate metabolism
eno00903  Limonene and pinene degradation
eno00930  Caprolactam degradation
eno01040  Biosynthesis of unsaturated fatty acids
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
eno01130  Biosynthesis of antibiotics
eno01200  Carbon metabolism
eno01212  Fatty acid metabolism
Module
eno_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECENHK_21130 (fadB)
   00650 Butanoate metabolism
    ECENHK_21130 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ECENHK_21130 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ECENHK_21130 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECENHK_21130 (fadB)
   00310 Lysine degradation
    ECENHK_21130 (fadB)
   00380 Tryptophan metabolism
    ECENHK_21130 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECENHK_21130 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECENHK_21130 (fadB)
   00281 Geraniol degradation
    ECENHK_21130 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECENHK_21130 (fadB)
   00930 Caprolactam degradation
    ECENHK_21130 (fadB)
Enzymes [BR:eno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECENHK_21130 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECENHK_21130 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECENHK_21130 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ECENHK_21130 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFP72055
Position
4507197..4509386
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGQALEVLEKQTELKGLLLRSN
KAAFIVGADITEFLSLFQVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQAQK
IGLVDGVVKPEKLVEGALAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
MQTAGKHYPAPITAVKTIEAAARLGRDEALKLENQSFVPLAHTNEARALVGIFLNDQFVK
GKAKQLTKNVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINEKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPVLEYSGFDRVDVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDGLLADVCQPKRDFTDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSARYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPVVEPA
RPVGELKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcaactggctggaagatggcattgccgaactg
gtgttcgatgcccccggctcagtgaacaagcttgataccgcgaccgtggccagtcttggc
caggcgttggaagtacttgaaaagcaaactgaattaaaagggctgctgctgcgctcaaac
aaagcagcctttattgtcggtgccgatatcaccgaattcctttccctgttccaggttcct
gaagaacagttgagccagtggctgcactttgctaacagcgtctttaaccgtctggaagac
ctgcctgttccgactatttccgccgttaatggttacgcattaggcggtggctgcgaatgc
gtgctggcaaccgactaccgtctggccacgccggatctgcgtatcggcctgccggaaacc
aaactggggatcatgcctggctttggcggatccgtccgtatgccgcgcatgctgggtgct
gacagcgcgctggagatcatcgccgccggtaaagatgtcggcgcggaacaggcgcagaaa
atcggcctggtggacggcgtggttaagccagaaaaactggttgaaggcgctctggctatt
ctgcgtcaggccattaatggcgatctcgactggaaagccaaacgccagccgaagcttgag
ccgttaaaactcagcaagatagaagccaccatgagcttcaccatcgccaaaggcatggtg
atgcagacggcgggtaaacactacccggcgccgatcacggcagtgaaaaccattgaagcg
gccgcccgtctgggccgtgacgaagccctgaaactggaaaatcagagcttcgtcccgctg
gcgcacaccaacgaagcccgcgcgctggttggcatcttcctgaacgatcagttcgtgaaa
ggcaaagctaaacagctgaccaaaaacgttgagaccccaaaacacgcggcggtactcggg
gcgggcattatgggtggcggcatcgcctaccagtcagcctggaaaggcgtgccggtagtg
atgaaagacattaacgagaaatccctgacgctgggcatgaccgaagcggccaagttgctg
aataaacagctggagcgcggcaaaattgacgggctgaagctcgcgggcgtgatctctacc
attcagcctgtgctggaatacagcggttttgatcgtgtggacgtggtcgttgaggcggtc
gtagagaacccgaaagtcaaaaaagcggtgctggcggaaacggaagacaaagttcgtccg
gataccgtactggcctctaatacctcgactattccgattagcgaactggcgagcgtactg
aagcgtccggaaaacttctgcggaatgcacttcttcaacccggtacaccgtatgccgctg
gtcgaagtgatccgaggggaaaaaacctctgacgaaaccatcgccaaagtggtggcgtgg
gcaagcaagatgggcaaaacgccgatcgttgttaacgactgcccgggcttcttcgtcaac
cgcgtactgttcccttacttcgccggtttcagccagctgctgcgagatggggcagacttc
cgcaaaatcgacaaagtgatggaaaaacagttcggctggccgatgggcccggcgtatctg
ctggacgtggtcggtattgataccgcccatcacgcccaggcggtgatggcggcaggcttc
ccgcagcgcatgcagaaagattatcgcgacgcgattgacgccctgttcgacgctaaccgc
ttcggtcagaaaaacggcctgggcttctggcgctataaagaagacagcaaaggcaaaccg
aagaaagaagaggatgcggcggtggatggcctgctggccgacgtatgccagccaaaacgc
gacttcaccgacgatgagatcatcgcccgcatgatgatcccgatgatcaacgaagtggtg
cgttgcctggaagaaggcattatcgccagcccggccgaagcggatatggcgctggtatac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccatcggcagc
gcccgctatctcgatatggctcagcagtatcagcacctcggcccgctctatgaagtgcct
gaagggctgcgcaacaaagcgcgccataacgaaccctattacccagtagttgagccagcc
cgtccggttggcgagctgaaaacggcttaa

DBGET integrated database retrieval system