KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21265Help
Entry
ECENHK_21265      CDS       T02315                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECENHK_21265
Enzymes [BR:eno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECENHK_21265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4537045..4538037)
Genome map
AA seq 330 aa AA seqDB search
MFQQKKDWETRENAFAAFSMGPLTDFWRQREEDEFTGVGGIPVRFVRFRDEKNDRVIVVC
PGRIESYVKYAELAYDLVHMGFDVLIIDHRGQGLSGRMLQDTHRGHVDRFSDYVDDFAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRYQHSCDAIALTAPMYGIVIRFPDWMVRHL
LDWAEGHQRIREGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADEPRLRVGGPTWHW
VREGILAGEQVLAGVGEDDTPTLLIQAEEERVVDNRMHDRYCELRAAAGHPCEGGKPLVI
NGAYHEILFEKDAMRSVALNAIVEFFNRHN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagaaaaaggactgggaaacacgagaaaacgcatttgctgctttctctatg
gggccgctgaccgatttctggcggcagcgtgaggaagatgagtttacgggcgtcgggggc
atcccggtacgcttcgttcgtttccgtgatgagaaaaatgaccgggtaatcgtggtttgc
ccggggcgcattgaaagctacgttaaatacgccgaactggcctacgatctggtccatatg
gggttcgatgtgctcatcatcgaccatcgtggacaggggctgtccggacgtatgctacag
gacacgcaccgtgggcatgtcgatcgcttcagcgattacgtcgacgattttgccgcgttc
tggcagcaggaagtgcagcccggcccctggcgtaagcgctatatccttgcgcactccatg
ggtggcgctatttcgacgctgtttttgcagcggtatcaacactcgtgtgatgccattgcg
ctaaccgcgccgatgtacggtatcgtcatacgtttccccgactggatggtgcgtcatctt
ctcgactgggctgagggccatcagcgcattcgtgaaggctatgccatcgggaccggacgc
tggcgtgcgctgccgtttgccatcaacgtcttaacccacagtcggcagcgttatcgccgc
aacctgcgcttttatgccgatgaaccgcgcttacgcgtcggtggcccgacctggcactgg
gtgcgggaggggattctggccggtgaacaggtgctggcgggggtaggcgaggatgacacg
ccaacactcctgattcaggctgaagaagagcgtgtggtcgataaccgcatgcatgaccgt
tattgtgaactgcgcgccgccgccggtcacccttgtgaagggggaaaaccgctggtcatc
aacggcgcttaccatgagatccttttcgaaaaggacgctatgcgctcagtcgcgctcaac
gccattgttgaatttttcaacaggcataactga

  All links  
No link information was found.   
DBGET integrated database retrieval system