KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21350Help
Entry
ECENHK_21350      CDS       T02315                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00860  Porphyrin and chlorophyll metabolism
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECENHK_21350 (hemD)
Enzymes [BR:eno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ECENHK_21350 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFP72099
Position
4555236..4555976
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEQLVSRLRTLGQVAWSFPLIEFSPGRELSALADRINTLQEGDLLFALS
QHAVEFANAQLQQQSLSWTTAPRYFAIGRSTALALHTVSGADVRYPLDREISEVLLQLPE
LQTIAGKRALILRGNGGRELLGETLRERGADVTFVECYQRCAKHYDGAEEAMRWHARGIN
TLVVTSGEMLQQLWSLIPHWYRENWLLRCRLLVVSERLANLARELGWQDIRIADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcttgtcacccgcccttctcccgcaggagagcagttagtgagccgtctgcgc
acactggggcaggtggcctggagttttccgctgattgaattctcccccggtcgcgagctc
tctgcgctcgccgatcggataaataccctgcaggaaggcgatctgctgtttgcgttgtcg
caacatgccgtggaattcgccaacgcccagctgcaacagcaaagtttgtcctggacaact
gccccacgctatttcgccattggtcgctcaacggcgctggcgctgcataccgtaagcggc
gctgatgttcgctacccgttagatcgggaaattagcgaagtcttgctacaattacctgaa
ttacaaactattgccggaaagcgcgcgctcattttgcgcggcaatggtggccgcgagctg
ctgggcgaaacgctgcgtgaacggggtgccgacgtgacgttcgttgagtgctatcagcgt
tgcgcaaagcactacgatggcgcggaagaagcgatgcgctggcacgcgcgcggcattaat
acgctggtggtcaccagcggtgaaatgttacaacagctttggtcgctgataccgcattgg
tatcgcgaaaactggttactccgctgtcggcttctggtcgtcagtgagcgtctggcgaac
ctcgcccgggaactgggctggcaggatattcggatcgctgataacgccgacaacgatgcg
ctgctgcgcgcattacaataa

DBGET integrated database retrieval system