KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21675Help
Entry
ECENHK_21675      CDS       T02315                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eno00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4635796..4637304
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQSST
LVEVLAKADISSDEIAAIGITNQRETTIVWERETGKPIYNAIVWQCRRTSEICEQLKRDG
MEEYVRSATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNINTLEWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NFRYSGWKKAVKRALAWEEHDE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaaaaatatatcgttgcgctcgaccagggcactaccagctcccgcgctgtc
gtaatggatcatgacgcgaacattgtcagcgtgtctcaacgtgaatttgagcaaatttac
cctcgtccaggctgggtagaacatgacccaatggagatctgggcttcacaaagctcaacg
ctggttgaagtactggcgaaagccgatatcagttccgacgagattgccgctatcggtatt
accaaccagcgtgaaacgacgattgtctgggaacgcgaaaccggtaagcctatctacaac
gctattgtctggcagtgccgccgtacctcagaaatctgtgaacagctgaagcgtgacggg
atggaagagtacgtgcgcagcgccaccggtctggtggttgacccgtacttctccggcacc
aaagtgaagtggatcctcgaccacgtggaaggttcacgcgagcgtgcaaaacgcggcgag
ctgctgttcgggaccgttgatacctggcttatctggaagatgacccagggacgcgttcac
gttaccgactacaccaacgcctcgcgtaccatgctgttcaacatcaacaccctggagtgg
gatgacaagatgctggacgcgctggatatcccacgcgcgatgctgcctgaagtgcgcaag
tcttcagaagtctacggtcagaccaacattggcggtaaaggcggcacccgtattcctatc
gccggtatcgccggtgaccagcaggcggcactgttcggccagctgtgcgtcaaagaaggg
atggcgaagaacacctacggcaccggctgctttatgctgatgaataccggtgagaaagcg
gtgaaatcagaaaacggcctgctgaccaccatcgcctgcggccctcgcggtgaagtgaac
tacgccctggaaggtgcggtgtttatggcgggtgcgtctattcagtggctgcgtgacgag
atgaagctgattagcgatgccttcgactccgaatactttgcgaccaaagtgaaggacacc
aacggtgtgtacgtggtgccagcgttcaccggcctgggcgcaccgtactgggatccctat
gcacgcggtgcgattttcggtctgacgcgtggtgtgaactcgaaccacattattcgcgcc
accctggaatccattgcctaccagacgcgcgacgtgctggaagcgatgcaggcagactcc
ggcattcgtctgcacgccctgcgcgtggacggcggtgcggtagcgaataacttcctgatg
cagttccagtccgacattctgggtacccgcgttgagcgccctgaagtgcgtgaagtcacg
gcgctgggtgcggcgtatcttgccggtctggcggtaggcttctggcagaacctggacgag
ctgcaggaaaaagcggttatcgaacgcgagttccgcccgggcatcgaaaccaccgagcgc
aacttccgctacagcggctggaagaaagcagtgaagcgcgccttggcgtgggaagagcac
gacgagtaa

DBGET integrated database retrieval system