KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21720Help
Entry
ECENHK_21720      CDS       T02315                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECENHK_21720
   01230 Biosynthesis of amino acids
    ECENHK_21720
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECENHK_21720
   00030 Pentose phosphate pathway
    ECENHK_21720
   00051 Fructose and mannose metabolism
    ECENHK_21720
   00052 Galactose metabolism
    ECENHK_21720
  Energy metabolism
   00680 Methane metabolism
    ECENHK_21720
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECENHK_21720
Enzymes [BR:eno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECENHK_21720
Protein phosphatases and associated proteins [BR:eno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECENHK_21720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4644813..4645775)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDEHIREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVAEIKAGIAKGKKHAIVAITEHICDVDELAKYIEAETK
RETRATVLGHIQRGGSPGPYDRILASRMGAYAIDLLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
attcgtggtgttgtccgtgcagcgctgacggaaggtctggaagtttttggtatctatgat
ggttacctgggtctgtatgaagatcgtatggttcagctcgaccgttacagcgtgtccgac
atgattaaccgtggcggtaccttccttgggtctgcgcgcttcccggaattccgtgacgaa
cacatccgtgaagtggctatcgagaacatgaaaaaacgcggtctggacgcgctggtggtt
atcggcggtgacggctcttacatgggtgcaaaacgtctgaccgaaatgggtttcccgtgc
atcggtctgccgggcaccatcgacaacgacatcaaaggtactgactacactatcggcttc
tttactgcactgggtaccgttgttgaagcgatcgaccgtctgcgcgatacctcgtcttct
caccagcgtatctctatcgttgaagtgatggggcgttactgcggtgacctgaccctggcc
gcggcgattgccggtggttgtgagttcgtggtggttccggaagtggaattcagccgtgaa
gatctggtcgctgaaatcaaagccggcatcgcgaaaggtaaaaaacacgcgatcgtggct
atcaccgaacacatctgtgacgttgacgagctggcgaagtacatcgaagccgaaaccaag
cgcgaaacccgcgcgaccgtactgggtcatatccagcgtggcggttcccctggcccttac
gaccgcattctggcgtcccgcatgggcgcgtacgctatcgatctgctgctgcagggtcac
ggcggccgttgcgtcggtattcagaacgaaaaactggttcaccatgacatcatcgacgcg
attgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system