KEGG   Enterobacter cloacae subsp. cloacae ENHKU01: ECENHK_21720Help
Entry
ECENHK_21720      CDS       T02315                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eno  Enterobacter cloacae subsp. cloacae ENHKU01
Pathway
eno00010  Glycolysis / Gluconeogenesis
eno00030  Pentose phosphate pathway
eno00051  Fructose and mannose metabolism
eno00052  Galactose metabolism
eno00680  Methane metabolism
eno01100  Metabolic pathways
eno01110  Biosynthesis of secondary metabolites
eno01120  Microbial metabolism in diverse environments
eno01130  Biosynthesis of antibiotics
eno01200  Carbon metabolism
eno01230  Biosynthesis of amino acids
eno03018  RNA degradation
Module
eno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECENHK_21720
   00030 Pentose phosphate pathway
    ECENHK_21720
   00051 Fructose and mannose metabolism
    ECENHK_21720
   00052 Galactose metabolism
    ECENHK_21720
  Energy metabolism
   00680 Methane metabolism
    ECENHK_21720
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECENHK_21720
Enzymes [BR:eno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECENHK_21720
Protein phosphatases and associated proteins [BR:eno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECENHK_21720
Messenger RNA biogenesis [BR:eno03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECENHK_21720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFP72171
Position
complement(4644813..4645775)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDEHIREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVAEIKAGIAKGKKHAIVAITEHICDVDELAKYIEAETK
RETRATVLGHIQRGGSPGPYDRILASRMGAYAIDLLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
attcgtggtgttgtccgtgcagcgctgacggaaggtctggaagtttttggtatctatgat
ggttacctgggtctgtatgaagatcgtatggttcagctcgaccgttacagcgtgtccgac
atgattaaccgtggcggtaccttccttgggtctgcgcgcttcccggaattccgtgacgaa
cacatccgtgaagtggctatcgagaacatgaaaaaacgcggtctggacgcgctggtggtt
atcggcggtgacggctcttacatgggtgcaaaacgtctgaccgaaatgggtttcccgtgc
atcggtctgccgggcaccatcgacaacgacatcaaaggtactgactacactatcggcttc
tttactgcactgggtaccgttgttgaagcgatcgaccgtctgcgcgatacctcgtcttct
caccagcgtatctctatcgttgaagtgatggggcgttactgcggtgacctgaccctggcc
gcggcgattgccggtggttgtgagttcgtggtggttccggaagtggaattcagccgtgaa
gatctggtcgctgaaatcaaagccggcatcgcgaaaggtaaaaaacacgcgatcgtggct
atcaccgaacacatctgtgacgttgacgagctggcgaagtacatcgaagccgaaaccaag
cgcgaaacccgcgcgaccgtactgggtcatatccagcgtggcggttcccctggcccttac
gaccgcattctggcgtcccgcatgggcgcgtacgctatcgatctgctgctgcagggtcac
ggcggccgttgcgtcggtattcagaacgaaaaactggttcaccatgacatcatcgacgcg
attgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system