KEGG   Enterobacter sp. R4-368: H650_01730Help
Entry
H650_01730        CDS       T02700                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
enr  Enterobacter sp. R4-368
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H650_01730
Enzymes [BR:enr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     H650_01730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
222652..223266
Genome map
AA seq 204 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LFNHNSSLFDEINAEHQQQAVHCVLVDECQFLTREQVYALSEVVDQLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTVCFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALQEGSLTTIQQRVRG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctttatttctactattcagcaatgaatgcggggaaatcaacagcgttacta
caatcctcttacaattatcaagaaagagggatgcgcacggtggtttacaccgccgaaatt
gacgatcgtttcggagcaggcaaggttagctctcgtatcggcttatcttcacccgcgcgg
ttgtttaatcacaactcctcgttgtttgacgaaatcaacgcagagcatcaacaacaagct
gtgcactgtgttctggtcgatgagtgccagtttttaacgcgtgaacaggtttatgcgtta
tcggaagttgtcgatcaactggatattccggtgctctgttacggtttgcgtacggatttt
cgcggtgagttatttgtaggtagccaatatttgctggcctggtcagataaactggttgag
ctgaaaactgtctgtttctgcgggcgtaaagccagtatggtgctgcgtcttgatcaagaa
gggcgcccttataacgaaggagaacaggtggtcattggcggtaatgaacgctatgtgtcc
gtgtgccgcaaacactacaaagaagcgctgcaagagggctctttaacgacgattcagcaa
cgcgtcagaggttag

DBGET integrated database retrieval system