KEGG   Enterobacter sp. R4-368: H650_07325Help
Entry
H650_07325        CDS       T02700                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
enr  Enterobacter sp. R4-368
Pathway
enr00220  Arginine biosynthesis
enr00250  Alanine, aspartate and glutamate metabolism
enr00290  Valine, leucine and isoleucine biosynthesis
enr01100  Metabolic pathways
enr01110  Biosynthesis of secondary metabolites
enr01130  Biosynthesis of antibiotics
enr01210  2-Oxocarboxylic acid metabolism
enr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H650_07325
   00290 Valine, leucine and isoleucine biosynthesis
    H650_07325
   00220 Arginine biosynthesis
    H650_07325
Enzymes [BR:enr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     H650_07325
    2.6.1.66  valine---pyruvate transaminase
     H650_07325
Amino acid related enzymes [BR:enr01007]
 Aminotransferase (transaminase)
  Class I
   H650_07325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGN84998
UniProt: R9VN38
Position
1400851..1402065
Genome map
AA seq 404 aa AA seqDB search
MSSIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPSAQGYCDSKGLYSARKAIMQHYQARGMREITVEDIYIGNGVSELIVQSMQALLNSGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESAGWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQHNLIIFADEIYDKILYDEAQHHSIAALAPDLFTITFNGLSK
TYRVAGFRQGWMVLSGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPSGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGSAFNWPWPDHVRIVTLPREDDLEMAITRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccatcgaaaaatccagcaaattagataacgtctgttacgacatccgtggcccg
gttctgaaagaagcaaaacgtcttgaagaagaaggcaacaaggtcctcaaactcaacatc
ggcaacccagcccctttcggcttcgaggcaccggatgaaattctggttgatgtgatccgc
aacctgcccagcgcgcaaggttactgcgattcaaaagggctctattccgcgcgcaaagcc
atcatgcagcactaccaggcgcgcggcatgcgcgaaatcactgtggaagacatctatatt
ggcaacggtgtttccgagttgattgtgcagtcgatgcaggcgttgctgaacagcggtgac
gaaatgctggtgcccgcaccggattacccgctgtggaccgctgcagtctcactctctggc
ggcaaagcggtgcactatttatgcgatgaatcggcaggctggttccccgatctcgatgat
atccgcgccaaaattacgccgcgtacgcgcgggattgtcattatcaacccgaacaaccca
accggcgcggtctactcaaaagagctgctgctggaaatcgttgagatcgcgcgtcagcac
aacctcatcatctttgcagatgaaatctacgacaaaattctttacgacgaagcgcagcat
cactccattgctgcactcgcgccggatctgttcaccatcacttttaacgggctgtcgaaa
acctatcgcgtcgcgggattccgccagggctggatggtgttgagcgggcctaaaaaacac
gcgaaaggctacattgaaggactggagatgctggcgtcgatgcgcctgtgcgccaacgtt
ccggctcaacatgcaattcagaccgcgctcggcggctaccagagcattagtgaatttatt
gtgcctggcggtcgcctgtatgaacagcgtaaccgcgcgtgggagctaattaacgagatc
ccgggcgtttcctgcgtgaaaccaagcggcgcgttgtatatgtttccgaaaatcgacgcc
aaacgcttcaatattcacgacgaccagaaaatggttctcgacttcctgttgcaggaaaaa
gtgctgctggtacaaggctctgcgtttaactggccatggccggatcacgtgcgaattgtg
acgttaccgcgtgaagacgatctggaaatggcgattacccgttttggtcgtttcctctcg
ggttaccatcagtaa

DBGET integrated database retrieval system