KEGG   Enterobacter sp. R4-368: H650_07325Help
Entry
H650_07325        CDS       T02700                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
enr  Enterobacter sp. R4-368
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    H650_07325
   01230 Biosynthesis of amino acids
    H650_07325
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H650_07325
   00290 Valine, leucine and isoleucine biosynthesis
    H650_07325
Enzymes [BR:enr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     H650_07325
    2.6.1.66  valine---pyruvate transaminase
     H650_07325
Amino acid related enzymes [BR:enr01007]
 Aminotransferase (transaminase)
  Class I
   H650_07325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1400851..1402065
Genome map
AA seq 404 aa AA seqDB search
MSSIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPSAQGYCDSKGLYSARKAIMQHYQARGMREITVEDIYIGNGVSELIVQSMQALLNSGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESAGWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQHNLIIFADEIYDKILYDEAQHHSIAALAPDLFTITFNGLSK
TYRVAGFRQGWMVLSGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPSGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGSAFNWPWPDHVRIVTLPREDDLEMAITRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccatcgaaaaatccagcaaattagataacgtctgttacgacatccgtggcccg
gttctgaaagaagcaaaacgtcttgaagaagaaggcaacaaggtcctcaaactcaacatc
ggcaacccagcccctttcggcttcgaggcaccggatgaaattctggttgatgtgatccgc
aacctgcccagcgcgcaaggttactgcgattcaaaagggctctattccgcgcgcaaagcc
atcatgcagcactaccaggcgcgcggcatgcgcgaaatcactgtggaagacatctatatt
ggcaacggtgtttccgagttgattgtgcagtcgatgcaggcgttgctgaacagcggtgac
gaaatgctggtgcccgcaccggattacccgctgtggaccgctgcagtctcactctctggc
ggcaaagcggtgcactatttatgcgatgaatcggcaggctggttccccgatctcgatgat
atccgcgccaaaattacgccgcgtacgcgcgggattgtcattatcaacccgaacaaccca
accggcgcggtctactcaaaagagctgctgctggaaatcgttgagatcgcgcgtcagcac
aacctcatcatctttgcagatgaaatctacgacaaaattctttacgacgaagcgcagcat
cactccattgctgcactcgcgccggatctgttcaccatcacttttaacgggctgtcgaaa
acctatcgcgtcgcgggattccgccagggctggatggtgttgagcgggcctaaaaaacac
gcgaaaggctacattgaaggactggagatgctggcgtcgatgcgcctgtgcgccaacgtt
ccggctcaacatgcaattcagaccgcgctcggcggctaccagagcattagtgaatttatt
gtgcctggcggtcgcctgtatgaacagcgtaaccgcgcgtgggagctaattaacgagatc
ccgggcgtttcctgcgtgaaaccaagcggcgcgttgtatatgtttccgaaaatcgacgcc
aaacgcttcaatattcacgacgaccagaaaatggttctcgacttcctgttgcaggaaaaa
gtgctgctggtacaaggctctgcgtttaactggccatggccggatcacgtgcgaattgtg
acgttaccgcgtgaagacgatctggaaatggcgattacccgttttggtcgtttcctctcg
ggttaccatcagtaa

DBGET integrated database retrieval system