KEGG   Enterobacter sp. R4-368: H650_10785Help
Entry
H650_10785        CDS       T02700                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
enr  Enterobacter sp. R4-368
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2105615..2106325)
Genome map
AA seq 236 aa AA seqDB search
MKKGLVMFTLLAAFTGAAHADDAAIKQSLAKLGVQSGEVLPAPVAGMKAVLTNSGVLYVT
EDGKHIIQGPMYDVSGAQPVNVTTKMLLPHLNALEKEMIVYKAPQEKHVITVFTDITCGY
CQKLHSEMADYNALGITVRYLAFPRQGVPSEVENQMKAIWCAKDPKKAFDNAMEGKEVKP
ASCDIDIANHYALGVQFGVNGTPAIVLNDGYLVPGYQAPAEMKAFLDQHQKATGGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttagtgatgttcaccctgctggctgcgtttaccggcgcggcgcatgcc
gatgatgcggctatcaaacagtcgctggcaaaactgggtgtacaaagtggtgaagtgctg
cccgcacctgttgccggaatgaaagccgtattgaccaacagcggcgtgctgtatgtaacc
gaagatggcaaacatatcatccagggaccgatgtacgatgtcagcggcgcgcagccagtg
aacgtcaccacgaagatgctgttaccgcatctgaacgcgctggaaaaagagatgattgtc
tacaaagcgccacaggaaaaacatgtcatcaccgtgttcaccgatatcacgtgtggctac
tgccagaaactgcatagcgaaatggcagactacaacgcgctcggcatcaccgtgcgttac
cttgccttcccgcgtcagggtgtgccaagcgaagttgaaaaccagatgaaggctatctgg
tgtgcaaaagatcctaaaaaagccttcgataacgcgatggaaggtaaagaggtgaaaccc
gccagctgcgatatcgacatcgccaaccattacgcgctgggcgtgcagtttggcgtcaac
ggcacgccagccatcgtgctgaatgacggctacctcgttccggggtatcaggctccggcg
gaaatgaaagccttcctcgatcaacatcaaaaagcgaccggcggtaaataa

DBGET integrated database retrieval system