KEGG   Enterobacter sp. R4-368: H650_11860Help
Entry
H650_11860        CDS       T02700                                 

Definition
muraminidase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
enr  Enterobacter sp. R4-368
Brite
Enzymes [BR:enr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     H650_11860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2344552..2345061)
Genome map
AA seq 169 aa AA seqDB search
MSSIVKRCSVVAVLALAALLPDFRLLRTSPDGLALLADLEGCRLRPYQCSAGVWTSGIGH
TAGVAPKRDITEREAAKNLVADVLNTERRLAVCAPVDMPPQVYDAVVSFAFNVGTGAACK
STLVYFLNQKKWQQACDQLPRWVYIDGVRNTGLENRRKRERDYCLKGAE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatcgttaagcgttgcagtgtggtcgcggtgctggcactggcggcactgttg
cctgattttcgtttactccgtacctccccggacgggctcgccctgctggcagaccttgag
gggtgccgtctgcgtccctaccagtgcagcgcgggggtatggacatcaggcatcggccac
actgccggggtcgcgccgaaacgcgatatcacggagcgtgaagcggcaaaaaatcttgtc
gctgacgtgctgaatacggagcgccgtcttgcggtctgtgcgccggtcgacatgccgccg
caggtttacgacgccgtggtcagtttcgcctttaacgtcggcaccggcgcggcgtgtaag
tcgacgctggtctatttcctgaaccagaaaaagtggcaacaggcatgtgaccagctcccg
cgctgggtctatatcgatggcgtcagaaataccgggctggaaaaccgccgcaagcgcgag
cgggattactgccttaagggggcagaatga

DBGET integrated database retrieval system