KEGG   Enterobacter sp. R4-368: H650_14040Help
Entry
H650_14040        CDS       T02700                                 

Definition
endonuclease III (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
enr  Enterobacter sp. R4-368
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H650_14040
Enzymes [BR:enr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     H650_14040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2772940..2774010)
Genome map
AA seq 356 aa AA seqDB search
MLAAVNVRAACTWPAWEHFKQAYISDGGRVVDPSDQRKITTSEGQSYALFFALAANDRDT
FARVLQWTQNNLAQGSLSTHLPAWLWGKKEDNSWTVLDTNSASDSDLWIAWSLLEAGRLW
KNDEYSQTGKALLALIAKEEVVTVPGLGSMLLPGKIGFAEPTTWRFNPSYLPPQLASYFS
RFGAPWSTLRETNLRLLLETAPKGFAPDWVRFQKEGGWQLKPEKTLVSSYDAIRVYLWVG
MMHDRDTQKARLLEKFKPMASVTTKNGRVPEKVDVASGKILGDGPVGFAAALLPFLQDRD
AQAVQRQRVADHFPGDDAYYSYVLTLFGQGWDQHRFRFTPRGELQPDWGQECATSQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcggtaaatgtgcgcgccgcctgcacctggcctgcctgggaacacttcaaa
caagcctatatcagcgatggcggccgggtggttgatcccagcgatcaacgcaagataacc
acctcggaagggcagagttacgcgctgttcttcgcgctggcggctaacgatcgtgacacc
ttcgccagggtactgcaatggacgcaaaacaacctggcgcagggctcgctcagtacccat
cttcccgcctggctgtggggcaaaaaagaggacaatagctggacggtgctcgacaccaat
tcggcgtccgactccgatctgtggattgcctggtcgctactggaagcggggcgtttatgg
aaaaacgacgagtatagccagacgggtaaggcgttgttagccctcatcgccaaagaagaa
gtggtgacggtcccagggctgggatcgatgctgctgcccggtaaaatcggctttgccgaa
ccgaccacctggcgttttaacccgagctatttgccgccgcaactggcgagttatttcagc
cgctttggcgcaccgtggtcgacgctgcgcgaaaccaaccttcgcctgttgctggaaacc
gcgccgaaaggctttgcacccgattgggtacgttttcagaaagagggcggctggcagctt
aaacccgaaaagacgctggtgagtagttatgatgccatccgcgtttatttgtgggtcggc
atgatgcatgaccgggacacgcagaaagcgcgcctgctggaaaaattcaaaccgatggcc
agcgtgactaccaaaaacggccgcgtgccggaaaaagtggatgtggcgagcggaaaaatt
cttggggatggcccggtggggtttgccgccgcgctgttgccctttttacaggatcgtgat
gcgcaagccgtacaacggcaacgggtcgccgatcatttccccggcgacgatgcctactat
agctatgttctgaccctgtttggccaggggtgggaccagcaccgttttcgcttcacccct
cgcggtgagttacaacctgactggggccaggaatgcgcaacttcacagtaa

DBGET integrated database retrieval system