KEGG   Enterobacter sp. R4-368: H650_14040Help
Entry
H650_14040        CDS       T02700                                 

Definition
(GenBank) endonuclease III (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
enr  Enterobacter sp. R4-368
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2772940..2774010)
Genome map
AA seq 356 aa AA seqDB search
MLAAVNVRAACTWPAWEHFKQAYISDGGRVVDPSDQRKITTSEGQSYALFFALAANDRDT
FARVLQWTQNNLAQGSLSTHLPAWLWGKKEDNSWTVLDTNSASDSDLWIAWSLLEAGRLW
KNDEYSQTGKALLALIAKEEVVTVPGLGSMLLPGKIGFAEPTTWRFNPSYLPPQLASYFS
RFGAPWSTLRETNLRLLLETAPKGFAPDWVRFQKEGGWQLKPEKTLVSSYDAIRVYLWVG
MMHDRDTQKARLLEKFKPMASVTTKNGRVPEKVDVASGKILGDGPVGFAAALLPFLQDRD
AQAVQRQRVADHFPGDDAYYSYVLTLFGQGWDQHRFRFTPRGELQPDWGQECATSQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcggtaaatgtgcgcgccgcctgcacctggcctgcctgggaacacttcaaa
caagcctatatcagcgatggcggccgggtggttgatcccagcgatcaacgcaagataacc
acctcggaagggcagagttacgcgctgttcttcgcgctggcggctaacgatcgtgacacc
ttcgccagggtactgcaatggacgcaaaacaacctggcgcagggctcgctcagtacccat
cttcccgcctggctgtggggcaaaaaagaggacaatagctggacggtgctcgacaccaat
tcggcgtccgactccgatctgtggattgcctggtcgctactggaagcggggcgtttatgg
aaaaacgacgagtatagccagacgggtaaggcgttgttagccctcatcgccaaagaagaa
gtggtgacggtcccagggctgggatcgatgctgctgcccggtaaaatcggctttgccgaa
ccgaccacctggcgttttaacccgagctatttgccgccgcaactggcgagttatttcagc
cgctttggcgcaccgtggtcgacgctgcgcgaaaccaaccttcgcctgttgctggaaacc
gcgccgaaaggctttgcacccgattgggtacgttttcagaaagagggcggctggcagctt
aaacccgaaaagacgctggtgagtagttatgatgccatccgcgtttatttgtgggtcggc
atgatgcatgaccgggacacgcagaaagcgcgcctgctggaaaaattcaaaccgatggcc
agcgtgactaccaaaaacggccgcgtgccggaaaaagtggatgtggcgagcggaaaaatt
cttggggatggcccggtggggtttgccgccgcgctgttgccctttttacaggatcgtgat
gcgcaagccgtacaacggcaacgggtcgccgatcatttccccggcgacgatgcctactat
agctatgttctgaccctgtttggccaggggtgggaccagcaccgttttcgcttcacccct
cgcggtgagttacaacctgactggggccaggaatgcgcaacttcacagtaa

DBGET integrated database retrieval system